KEGG   Pantoea ananatis LMG 5342: PANA5342_1730
Entry
PANA5342_1730     CDS       T01728                                 

Gene name
hcp5
Definition
(GenBank) type VI secretion system effector, Hcp1 family
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
plf  Pantoea ananatis LMG 5342
Pathway
plf03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:plf00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PANA5342_1730 (hcp5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:plf02044]
    PANA5342_1730 (hcp5)
Secretion system [BR:plf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PANA5342_1730 (hcp5)
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: CCF09123
Position
1831205..1831687
AA seq 160 aa
MAIDMYLKVDGITGESKDSNHTGWIDITSFSWGANQPGNMSVGGGGGAGKVNFNDLHINA
KIDKAVTALLKNCASGKHVTKVEVSVCKAGGTQIEYTRITLEDVLVTNVQFVGSEHDDTL
GVTYAFQAAKVKQQYWEQSSSGGKGAESSAGWNIKENKEA
NT seq 483 nt   +upstreamnt  +downstreamnt
atggctattgatatgtatttgaaggtagacggtattactggtgaatctaaagattcaaac
cataccggctggattgatattacctctttctcctggggcgctaatcagccgggtaatatg
agcgtgggcggcggcggcggtgctggtaaagtaaacttcaacgacctgcacattaatgcc
aaaatcgacaaggctgtcactgcgctgttgaaaaactgtgccagtggtaagcacgtcact
aaggttgaagtttcagtttgcaaggctggcggtacgcaaatcgagtacacccgcatcacc
ctggaagacgtgctggtcaccaacgtacagttcgtgggctctgagcacgatgatacgctg
ggcgtaacctatgcattccaggctgcgaaagtgaaacagcagtactgggagcagagctct
tctggcggtaaaggcgcagaaagcagcgctggctggaatatcaaagagaataaagaagcg
taa

DBGET integrated database retrieval system