KEGG   Pantoea ananatis LMG 5342: PANA5342_1951Help
Entry
PANA5342_1951     CDS       T01728                                 

Gene name
gldA
Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
plf00561  Glycerolipid metabolism
plf00640  Propanoate metabolism
plf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:plf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    PANA5342_1951 (gldA)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    PANA5342_1951 (gldA)
Enzymes [BR:plf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     PANA5342_1951 (gldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase Peripla_BP_6 AIRC PFK
Motif
Other DBs
NCBI-ProteinID: CCF09344
Position
complement(2049285..2050379)
Genome map
AA seq 364 aa AA seqDB search
MKFIFSSPRKYVQGAGVLDELGSYVTELGTQAFVVADDVVWGLIGERAQATLTKAGVNVV
RQQFNGEASSNEITRLSQQAQQQNCNVVIGLGGGKTLDTVKAVADEIQQPVVIVPTIAST
DAPCSALSVIYSDSGVFESYRFYNKNPDLVLVDTAVCAAAPARLFASGIADGLATWVEAQ
AVARSHAKSMVNGDPTIAGLAIARACEETLLTWGYSAYVAVSEKRVTPAVEAVVEANTLL
SGLGFENAGLAAAHAIHNGFTAIEGDIHHLTHGEKVAYGTLTQMVLEQRPDEEIARYIRF
YRSIKMPTTLKEMHLEGESWENLVKIGALANSEGDTLKNLNPNLAPEQIAHALLGLDAFS
QTVK
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttattttctcgtcaccgcgcaaatatgtgcaaggtgcaggcgtactcgatgaa
ctggggagctacgtcaccgaactgggtactcaggcttttgtggtcgcggacgatgtcgtc
tggggactgatcggtgaacgggctcaggccacgctcacaaaggcgggcgtgaacgtggtg
cgccagcagttcaacggcgaggcgtccagtaatgaaatcacccggttgagccagcaggcg
caacagcagaactgcaacgtggtcatcgggctgggcggcggtaaaacgctggataccgtt
aaggcagtggctgatgagatccaacaaccggtggtgatcgttcccacgattgcctctacc
gatgcgccctgtagcgcactctccgttatctattctgacagcggcgtgtttgagagctac
cgcttctacaataagaaccccgatctggtgctggtggataccgccgtctgtgccgctgcg
cctgcccgcctgtttgcctcgggcattgcggatggcctcgcaacctgggtggaagcccag
gcggtagcccgcagccatgccaaatcgatggtcaatggcgatccgaccattgccgggctg
gccatcgcccgtgcctgtgaggaaaccctgctgacctggggttacagtgcctatgttgcc
gtttcggaaaaacgcgtgacgccggcggtggaagcggtggtggaagcgaataccttgctg
tcgggcctgggattcgaaaatgccggcctggcagctgcgcacgccattcataatggtttt
actgctattgaaggcgatatccatcatctcacccacggcgagaaagtggcctacggtacc
ttaacccagatggtgctggagcagcgtccggacgaggagatcgcacgctacatccgtttc
tatcgctcgatcaagatgcccaccaccctgaaagagatgcatctggagggcgaaagctgg
gaaaatctggtgaaaataggcgcactggcaaacagtgaaggcgatacgctgaaaaacctt
aaccccaacctggcaccggagcaaattgcccatgcgctgctggggctggatgcgttcagt
caaacggtaaaataa

DBGET integrated database retrieval system