KEGG   Pantoea ananatis LMG 5342: PANA5342_2022Help
Entry
PANA5342_2022     CDS       T01728                                 

Gene name
rrmA
Definition
(GenBank) ribosomal RNA large subunit methyltransferase A RrmA
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
plf  Pantoea ananatis LMG 5342
Brite
KEGG Orthology (KO) [BR:plf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:plf03009]
    PANA5342_2022 (rrmA)
Enzymes [BR:plf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     PANA5342_2022 (rrmA)
Ribosome biogenesis [BR:plf03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    PANA5342_2022 (rrmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_31 Methyltransf_25 Methyltransf_11 Ubie_methyltran MTS Methyltransf_23 Methyltransf_32 Methyltransf_12 PCMT PrmA Methyltransf_29 Methyltransf_4 FtsJ MetW Methyltransf_3 Methyltransf_9 DUF938
Motif
Other DBs
NCBI-ProteinID: CCF09415
Position
2123902..2124711
Genome map
AA seq 269 aa AA seqDB search
MSLNCPLCHFPLTLTDRSWRCENRHQFDQAKEGYVNLLPVQHKGSREPGDSADMMQARRA
FLQAGHYQPLRDNVVAVLNQHLNQPAAQILDIGCGEGYYTGALASELAPEGQVYGLDVAK
MAVRLAAKRYAQVLFCVASSHRLPFGDASLDAVVRIYAPCNETELSRVIKPGGFLLTVTP
GPHHLQQLKALIYRDVQLHASEEKSYQGFRQLAQHRLTYPMTLSGQSATTLLQMTPFAWR
ARPDVWQSLAESTQFPCDADFMITLWQRD
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgtctttgaactgcccactttgtcacttccccctgaccctgactgaccgcagctggcgc
tgtgaaaatcgccatcagttcgatcaggcgaaagagggctacgtcaatttgctgcccgtt
caacataaaggttcacgtgaaccgggcgacagtgcagacatgatgcaggcgcgacgtgcg
tttctgcaggccggtcactaccagcctttgcgggacaacgtggttgccgtccttaaccag
catctgaaccaaccggctgcgcagattctggatatcggctgtggagaaggctactacacg
ggcgcactggccagcgagctcgcgcctgagggccaggtttatggtctggatgtggcgaag
atggccgtcaggctggcggcaaagcgttacgcccaggttttattttgcgtggcatcaagc
caccgcctgccgtttggtgatgcttcgctggatgcggtggtccgcatttatgcgccctgt
aacgagactgagctcagccgggtcattaaaccgggaggctttttactcacggtcacgccc
gggcctcatcatcttcagcagcttaaggcgctgatataccgcgacgttcaactccacgcc
tcggaagagaaaagctaccagggatttcgtcaactcgcccagcatcgtttaacgtatcca
atgacgttgagcgggcagtctgccaccaccttgttgcagatgacgccctttgcctggcgc
gcgcgacctgatgtgtggcagagcttagcggaaagtacgcagtttccctgcgacgcagac
tttatgatcaccctgtggcaacgcgattag

DBGET integrated database retrieval system