KEGG   Pantoea ananatis LMG 5342: PANA5342_2175Help
Entry
PANA5342_2175     CDS       T01728                                 

Gene name
rstB
Definition
(GenBank) two-component regulatory system, sensor kinase
  KO
K07639  two-component system, OmpR family, sensor histidine kinase RstB [EC:2.7.13.3]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
plf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:plf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PANA5342_2175 (rstB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:plf01001]
    PANA5342_2175 (rstB)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:plf02022]
    PANA5342_2175 (rstB)
Enzymes [BR:plf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     PANA5342_2175 (rstB)
Protein kinases [BR:plf01001]
 Histidine kinases
  OmpR family
   PANA5342_2175 (rstB)
Two-component system [BR:plf02022]
 OmpR family
  RstB-RstA
   PANA5342_2175 (rstB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA HAMP HATPase_c_3 HATPase_c_2
Motif
Other DBs
NCBI-ProteinID: CCF09568
Position
complement(2282431..2283732)
Genome map
AA seq 433 aa AA seqDB search
MKKLFIQFYLLLFVCFLVMSLMVGLVYKFTAERAGRQSMNDLMASSLYLIRSELREIPPR
DWNKTIKSLDLGLSFELHIEPMSKFELDENELRRLRAGEIVALDDKYTFLQHIPRSHYVL
TVGPIPYLFYLHQMRLLDMALVVFIGMSLGLPVFIWLRPHWKEMLRLEHAAQRFGQGQLD
VRTHFDSTSSLFRVGVAFNQMAENINTLVASKKQLIDGIAHELRTPLVRLRYRLEMSDNL
TEAESAALNRDVSQLESLIEELLTYARLDRPRVDLNLQSLDLANWLRERMEDFRAINPET
QIDLDLPQRENYGISDTRLMERVLDNLVNNALRYAGQRLRVSLWFDGALGNLQVEDDGPG
IPLDERERVFEPFVRLDPSRDRATGGCGLGLAIVHSIAHALSGRVSIETSPLGGASVRFC
WPLDLPFRELPRR
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactttttattcagttctacctgctgctgtttgtctgtttcctggtgatgtcg
ctaatggtcgggctggtttacaaatttaccgccgagcgtgccggtcgccagtcaatgaac
gacctgatggccagttcgctctatctgatccgcagcgaactgcgtgagatcccgccacgg
gactggaataagacgattaagagtctcgatctcggcttgtcgtttgagctgcatattgag
ccaatgagtaagtttgaactggatgaaaatgaactgcgccggctgcgcgcaggcgaaatc
gtggcgctggatgataaatacactttcctgcagcacattccccgcagccactacgttctg
accgttgggccaatcccttacctgttttatctgcaccagatgcgcctgctggatatggcc
ctggtggtgtttatcgggatgtcgctggggttgccggtttttatctggctgcgtccgcac
tggaaagagatgctgcggctggagcacgcggctcagcgttttggtcagggacagcttgat
gtccgcacgcacttcgacagcacctctagcctgttcagggtcggcgtggcttttaaccaa
atggcggaaaacattaatacgctggtcgccagtaaaaaacagctgattgacggcatcgcc
cacgaactgcgaacgccgctggtacgtttgcgctatcgtctggagatgagcgacaatctg
accgaagcggagtcagcggcattgaaccgcgatgtcagccagttagaaagcctgattgaa
gagctgctgacctatgcccgtctcgatcggccccgcgtcgatcttaatttgcagtcgctg
gatctggcgaactggttacgtgagcgcatggaagatttccgggcgataaacccggagaca
cagatcgatcttgatttaccccagcgtgaaaactacgggatttcagatacccgactgatg
gagcgcgtactggataacctggtcaataacgcactgcgttatgccggtcagcgcctgcgg
gttagcctgtggtttgatggtgcgctggggaacctgcaggtcgaagatgatggcccgggc
attccccttgatgaacgtgaacgcgtatttgaaccttttgtacgactcgacccaagccgt
gaccgcgccaccgggggctgtgggcttggccttgccatcgttcactctattgcccatgca
ttaagtggccgggtttctattgaaaccagcccgcttggcggggccagcgttcgcttttgc
tggccgctggatcttccctttcgggaactgccacgacgttaa

DBGET integrated database retrieval system