KEGG   Pantoea ananatis LMG 5342: PANA5342_2244Help
Entry
PANA5342_2244     CDS       T01728                                 

Gene name
aldA3
Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
plf00010  Glycolysis / Gluconeogenesis
plf00053  Ascorbate and aldarate metabolism
plf00071  Fatty acid degradation
plf00280  Valine, leucine and isoleucine degradation
plf00310  Lysine degradation
plf00330  Arginine and proline metabolism
plf00340  Histidine metabolism
plf00380  Tryptophan metabolism
plf00410  beta-Alanine metabolism
plf00561  Glycerolipid metabolism
plf00620  Pyruvate metabolism
plf00625  Chloroalkane and chloroalkene degradation
plf00903  Limonene and pinene degradation
plf01100  Metabolic pathways
plf01110  Biosynthesis of secondary metabolites
plf01120  Microbial metabolism in diverse environments
plf01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:plf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PANA5342_2244 (aldA3)
   00053 Ascorbate and aldarate metabolism
    PANA5342_2244 (aldA3)
   00620 Pyruvate metabolism
    PANA5342_2244 (aldA3)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PANA5342_2244 (aldA3)
   00561 Glycerolipid metabolism
    PANA5342_2244 (aldA3)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PANA5342_2244 (aldA3)
   00310 Lysine degradation
    PANA5342_2244 (aldA3)
   00330 Arginine and proline metabolism
    PANA5342_2244 (aldA3)
   00340 Histidine metabolism
    PANA5342_2244 (aldA3)
   00380 Tryptophan metabolism
    PANA5342_2244 (aldA3)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PANA5342_2244 (aldA3)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PANA5342_2244 (aldA3)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PANA5342_2244 (aldA3)
Enzymes [BR:plf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     PANA5342_2244 (aldA3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: CCF09637
Position
2352275..2353747
Genome map
AA seq 490 aa AA seqDB search
MSDFDPDKVRLSTGHFINGQFVSASGKTMGIKRPSDGQHYADINEAGAETVGEAVSLAED
ARIRSGWSSCSPRERGAAISRWADLIDADKDYLAQLEAVGSTRPITDTINIEVPFTAAAL
RFYAECADKYSGDVFPTQNSSLGMLVPEPYGVIGAITPWNFPLSMASWKCGPALAAGNAV
VLKPSELTPFSTARLAELAVQAGIPPGVLNVVQGGGQVTGNALVTHPLVRKVSFTGSTAT
GAAIMSQAALQGTKPVTLELGGKSPQLVFDDAGDADEIAKRLFLGFTVNAGQACVSGTRL
IIQKGIAERVIEKLIALCKTPLPGMTWQAATRYCPLIDQRQGEKVATIIARSVAQGASIL
AGGQRYENTAQGWFWQPTLLANVNQDNVAIQEEIFGPVLTIQTFSDEEEALALAQHRVFG
LCAGVHTLNMPRAMRLMKALDSGTVWINRYRRTWDFIIPTGGFQGSGFGKDLGRQAFESC
QRYKSVLIDF
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgtcagattttgatcccgataaggtccgtctttcgaccgggcattttatcaacggccag
tttgtttcggcatccggcaaaacaatgggaattaaacgtccctcggatggccagcattat
gccgacatcaacgaagcgggcgcagagacggtcggcgaggcggtcagcctcgcggaagac
gcgcgcattcgcagcggctggtcaagctgctcgccacgcgaacgtggcgcggccatttcc
cgctgggcggatttgatcgatgccgacaaagattatctggcgcagcttgaggcggtgggc
tccacgcgtccgataacggacacgatcaatattgaagtgcctttcaccgctgctgctctg
cgtttttatgcagaatgcgcagacaagtacagcggagatgtgtttccaacccagaacagt
agcctgggaatgctggtgccggaaccttatggcgtgatcggcgcgatcacgccgtggaat
ttcccgctgtcgatggcgtcgtggaagtgcggcccggcgctggctgcgggaaacgcggtg
gtgctcaagccctctgagctgacgccattctccaccgcgcggctggctgagctggccgtg
caggccggtattccgcccggcgtgctcaacgtcgttcagggcggcggacaggtcaccggc
aatgcactggtgacccatcctctggtcagaaaggtgtcctttaccggttcaaccgcgacc
ggggcggcgatcatgagccaggccgcgttacagggtaccaagcccgtgacgctggaactg
ggcggaaaaagcccgcagctggtttttgacgatgcaggcgatgcggatgaaatcgccaag
cgcctgtttctgggcttcaccgtcaacgccggtcaggcctgtgtttcagggacgcgtctg
atcattcagaaaggtatcgcggaacgggtcatcgaaaagcttatcgccctgtgcaaaaca
ccgctgcccggtatgacctggcaggccgccacgcgttactgtccgctgatcgatcaacgt
cagggggaaaaagtcgcgacgattatcgcgcggtccgtggcgcagggggccagcattctg
gccggcggccagcgttacgaaaacaccgcgcagggctggttctggcaaccgacgctgtta
gccaatgtgaatcaggataacgtcgcgattcaggaggagatcttcggaccggtgctgacc
atccagacgtttagcgatgaagaagaagccctggcgctcgcacagcatcgcgtttttggc
ttatgtgcaggcgtgcatacgctcaacatgccacgtgcgatgcggctgatgaaagccctg
gacagcggtacggtctggatcaaccgctatcgtcgaacctgggactttatcattccaacc
ggcggctttcaggggtccggttttggcaaagatcttgggcgccaggcctttgagtcatgt
cagcgctacaagagtgtcttaatcgatttttaa

DBGET integrated database retrieval system