KEGG   Pantoea ananatis LMG 5342: PANA5342_2250Help
Entry
PANA5342_2250     CDS       T01728                                 

Definition
(GenBank) hypothetical protein
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
plf00970  Aminoacyl-tRNA biosynthesis
plf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:plf00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PANA5342_2250
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:plf03029]
    PANA5342_2250
Enzymes [BR:plf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     PANA5342_2250
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     PANA5342_2250
Mitochondrial biogenesis [BR:plf03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    PANA5342_2250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: CCF09643
Position
2359161..2360537
Genome map
AA seq 458 aa AA seqDB search
MQAENVRQLFMAGQIDALGISALYAQQRLSPLAFTTACLKAAENAPSVFISMTAARAREE
AEASTLRWQACRPLSPLDGIPVAWKDLFDIQSSQTSAGSATRSNVPVAPQDAALVAQCSA
AGLVTLGKTNLSEFAFSGLGLNPSFGTPAIRGTTSQLFAPGGSSSGAGRAIAEGLACIAF
GTDTGGSIRIPAAFSGTIGYRASRQRYVTTGVYPLAHSLDTVGPLCRSVRDAIALDDILC
GAQKMRFPAPHFRVDEALLAACQPAVRENACRRIAQLTAAGFRIDHAPLQAFNQALAWIA
DKGWPGGREAWLLHRELLASPDAALMDARVRERLFAASHQDPAVLETFLAQRKSWQQALA
AELDGAVLITPTVAHTAPELAPLMQDDDLFAQTNLATLRLTMPGSLLDMPGIALPTGKDA
NGLYTSLLFSLPAGEDRRLLHAASTVAGTFTADHSVCA
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggccgaaaatgttcgtcagttattcatggctggtcagattgatgcgctgggaatc
agtgcgctctatgcacaacagcgcctgtcgccgctggcctttaccacagcctgtctaaaa
gcggctgaaaacgcgccttccgttttcatctcaatgaccgccgcccgtgcccgcgaagag
gccgaagcctcaacgctgcgctggcaagcgtgccgcccgctgagcccactggatggtatt
ccggtggcctggaaagatctgttcgatattcagtcaagccaaacctccgccgggtcggcc
acgcgaagcaatgtccctgtcgcaccacaggatgccgcgctggtggcacagtgttcggca
gcaggactggtgacgctgggtaaaaccaacctgagtgaattcgcgttttccggccttgga
ctcaatcccagttttggtacgccggccatccggggcaccacgtcgcagctttttgcaccc
ggaggatcgtccagcggcgcgggacgggcaattgcggaaggtctcgcctgtatcgccttt
ggcaccgacaccggcggctcaatacggattcctgccgcattcagcggcacgattggctat
cgcgccagtcgccagcggtatgtgacaacgggcgtctatcctctggcgcactcgctggac
acggtggggccgctatgccgaagcgtacgtgatgctattgccctggatgacattctgtgc
ggcgcgcaaaaaatgcgctttcctgcgccgcactttcgtgtggacgaggcattacttgcc
gcgtgccagcccgccgtgcgtgagaacgcttgtcgccggatagcccagttgacggccgcc
gggttcagaattgatcacgcgccacttcaggcctttaaccaggcactggcctggattgcc
gataaaggctggccgggtggacgtgaggcctggctgctgcatcgcgaactgttagcctcg
cctgacgcggcattgatggatgcgcgcgtgcgggaacgcctgtttgccgccagccatcag
gatcctgcggtgcttgaaacgtttctggcgcaacgcaagtcgtggcaacaggcactggcg
gcagaactggacggggcagtgctgattacgcctaccgttgcccacaccgcaccggaactg
gcccccttgatgcaagacgacgacctgtttgcccagaccaatcttgccacgctgcggtta
accatgccgggcagtctgctggatatgccgggaatcgctttgccgaccggcaaagacgca
aacgggctgtataccagcctgcttttttcccttcctgctggcgaggatcgccggcttctt
cacgctgccagcacggtcgcaggcacgtttacggcagaccattccgtctgcgcttaa

DBGET integrated database retrieval system