KEGG   Pantoea ananatis LMG 5342: PANA5342_3088Help
Entry
PANA5342_3088     CDS       T01728                                 

Gene name
gpmA1
Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
plf00010  Glycolysis / Gluconeogenesis
plf00260  Glycine, serine and threonine metabolism
plf00680  Methane metabolism
plf01100  Metabolic pathways
plf01110  Biosynthesis of secondary metabolites
plf01120  Microbial metabolism in diverse environments
plf01130  Biosynthesis of antibiotics
plf01200  Carbon metabolism
plf01230  Biosynthesis of amino acids
Module
plf_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
plf_M00002  Glycolysis, core module involving three-carbon compounds
plf_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:plf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PANA5342_3088 (gpmA1)
  Energy metabolism
   00680 Methane metabolism
    PANA5342_3088 (gpmA1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PANA5342_3088 (gpmA1)
Enzymes [BR:plf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     PANA5342_3088 (gpmA1)
Membrane trafficking [BR:plf04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    PANA5342_3088 (gpmA1)
Exosome [BR:plf04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   PANA5342_3088 (gpmA1)
  Exosomal proteins of melanoma cells
   PANA5342_3088 (gpmA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CCF10481
Position
3227507..3228259
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSDKGRTEAKAAGQLLKKEGFVFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWRLNERHYGALQGLDKAETAAKYGDEQVKQWRRGFA
VTPPELDRSDERFPGHDPRYASLKPEQLPTTESLALTIERVIPYWNESILPRIKSGEKVI
VAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPIKHYYLGDADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggtgcgacacggcgaaagccagtggaacaacgaaaac
cgcttcaccggatggtatgatgtagacctttctgacaagggccgtaccgaagctaaagca
gccggacagctgctgaagaaagaaggtttcgtgtttgatttcgcctacacctctgtgctg
aaacgcgccattcacaccctgtggaatgtgctggatgagctggatcaggcctggctgccc
gttgagaaatcctggcgtctgaacgaacgtcactatggcgcgctgcagggcctggacaaa
gctgaaaccgccgcaaaatacggcgacgagcaggttaaacagtggcgtcgtggcttcgcg
gtgactccgccagagttggaccgcagcgatgagcgttttcctggacacgacccgcgttat
gcttcactgaagcctgagcagctgcccaccaccgaaagcctggcgctgaccatcgaacgc
gtgatcccttactggaacgaatccattctgccacgtatcaaaagtggtgagaaagtgatc
gtggcggcccacggtaactcactgcgtgcgctggtgaaatacctggacaacatgagcgaa
gaagagattcttgaactgaatatcccgaccggcgttccgctggtgtacgagttcgatgaa
aacttcaaaccgatcaaacattactacctgggtgatgctgacgagatcgcagcgaaagcc
gcggccgttgccaatcagggtaaagcgaagtaa

DBGET integrated database retrieval system