KEGG   Pantoea ananatis LMG 5342: PANA5342_3511Help
Entry
PANA5342_3511     CDS       T01728                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
plf00900  Terpenoid backbone biosynthesis
plf01100  Metabolic pathways
plf01110  Biosynthesis of secondary metabolites
plf01130  Biosynthesis of antibiotics
Module
plf_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:plf00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PANA5342_3511 (dxr)
Enzymes [BR:plf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     PANA5342_3511 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C
Motif
Other DBs
NCBI-ProteinID: CCF10904
Position
complement(3666990..3668198)
Genome map
AA seq 402 aa AA seqDB search
MDSIMKRLTLLGSTGSIGTSTLAVVSANPTRYQITALVAGKNVALMAEQCVQFQPRYAAM
ADEEAAVALRERLRALKVKTEVLSGVQAACELAALDEVDQVMAAIVGASGLLPTLAAIRA
GKTVLLANKESLVTCGRLFMEAVRQHKAQLLPVDSEHNAIFQSLPATIQHQLGYADLQNN
GIESIILTGSGGPFRDTNLADLRNMSPDQACAHPNWSMGRKISVDSATMMNKGLEYIEAR
WLFNASAAQMEVILHPQSVIHSMVRYCDGSVLAQLGSPDMRTPIAHSMAWPARIHAGVTP
LDFTRMSALTFSEPDFGRYPCLKLAIDACEAGQAATTTLNAANEIAVAAFLNQRIRFTDI
AALNSAVLSSQHGQEPDSVDAVIEIDRMARAAATEMLPRFTA
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggacagcattatgaagcgattaactctgctcggttcaaccggttcgataggcaccagc
acgctggcagtcgtcagtgccaatcctacgcgctatcagatcacggcgctggttgccggt
aaaaacgtggccctgatggctgagcagtgcgtacagttccaaccccgctatgcggcgatg
gcagacgaagaagccgctgttgcgctacgtgagcgactgagagcattgaaggtgaagact
gaagtgctctccggcgttcaggcagcctgtgaactggccgcgctggatgaggttgaccag
gtgatggcggcgattgtgggcgcctcaggtttactgcccacgttggcagcgattcgcgcg
ggtaaaaccgtcctgctggcgaataaagaatccctggtgacgtgcggccgtttatttatg
gaggcggtgcgccagcataaggcgcagctgttgccggtagacagcgagcacaatgcgatt
tttcagagtttgcccgctaccatccagcatcagttaggttacgctgacctgcagaataac
ggcattgagtcgattattcttacgggatcgggtggcccttttcgtgacacaaatttagcg
gatctgcgcaatatgtcgccagatcaggcttgtgcacatccgaactggtcaatggggcgt
aaaatctcggttgattcggccaccatgatgaataaaggtcttgaatacattgaagctcgt
tggctgttcaacgccagtgccgcgcagatggaagtgattttgcacccccaatcggtgatc
cactccatggtgcgttactgcgatggcagcgtgctggcacagttaggttcacctgacatg
cgaacccctatcgcccacagtatggcctggccagcgcgtattcacgctggggtcacaccg
ctggactttacccgcatgtcggcgctgacgttctcagaacctgattttggccgttacccc
tgtcttaaactggcaattgatgcctgcgaggccgggcaggcggccaccaccacgcttaat
gctgccaatgagatcgccgtggcggcgttcctgaatcagcgaattcgttttaccgatatc
gcagcgttaaacagcgcagtgctgtcatcgcagcacggccaggaaccggattcagtggac
gctgtcatcgaaatcgatcgtatggcacgcgccgctgcgaccgaaatgttgccacgcttc
acggcataa

DBGET integrated database retrieval system