KEGG   Pantoea ananatis LMG 5342: PANA5342_3629Help
Entry
PANA5342_3629     CDS       T01728                                 

Gene name
apaG
Definition
(GenBank) ApaG domain-containing protein
  KO
K06195  ApaG protein
Organism
plf  Pantoea ananatis LMG 5342
Brite
KEGG Orthology (KO) [BR:plf00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    PANA5342_3629 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: CCF11022
Position
3806183..3806560
Genome map
AA seq 125 aa AA seqDB search
MSEPARVSLHVQSLYVASQSSPEDERYVFAYTVTIRNVGRSSVQLLRRYWLITNGNGRET
EVQGEGVIGEQPHIAPGNEYQYTSGAVLETPMGTMQGHYVMVDEQGDEFHVEIPVFRLAI
QTHIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaccggcccgcgtatcgctgcacgtacaaagtctgtatgtcgcctcacagtcc
tcaccggaagatgagcgctatgtctttgcttataccgtcacgattcgcaacgtaggccgg
tcctcagtgcaactgctccgacgctactggctcatcactaacggcaatggccgtgagacg
gaagttcagggtgaaggcgtcataggcgaacagccgcatattgcaccgggaaacgaatat
cagtacaccagcggtgctgttcttgaaaccccgatgggcaccatgcaaggtcactatgtg
atggtcgatgagcaaggcgatgaattccacgtcgagatcccggtattccgcctcgcgatt
caaacccacatccattga

DBGET integrated database retrieval system