KEGG   Pantoea ananatis LMG 5342: PANA5342_4266Help
Entry
PANA5342_4266     CDS       T01728                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
plf00860  Porphyrin and chlorophyll metabolism
plf01100  Metabolic pathways
plf01110  Biosynthesis of secondary metabolites
plf01120  Microbial metabolism in diverse environments
Module
plf_M00121  Heme biosynthesis, glutamate => heme
plf_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:plf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PANA5342_4266 (hemD)
Enzymes [BR:plf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     PANA5342_4266 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 CUE
Motif
Other DBs
NCBI-ProteinID: CCF11659
Position
4517567..4518295
Genome map
AA seq 242 aa AA seqDB search
MTILVTRPEPAAAELVSRLHAQGKQAWSLPLIEFAPGNDLLQLPATLATLKRGDLVFLLS
QQVIHFAQHAIKAWPADVDYYAIGRSTALAFHTISGLQVTYPHAHETSEELIKLATLQQI
AGKHALILRGNQGRELLSETLAARGAQVTYAECYQRCQKHYDGAIEGRRWRDRNIHTLVV
TSGEMLHQLYSLFPEVDREEWLLRCRLVVVSERLASLAADLGWQTIQVADGADNDALLRA
LC
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgacgattctggtgacgcgcccggaacccgcagcggcggagctggtctcgcgcctgcac
gcccagggtaaacaggcgtggagcctgccgctgatagaattcgcgccgggtaacgatctc
ctgcagttaccggccacccttgccacgttgaaacgcggcgatctcgttttcctcctttcg
cagcaggttattcactttgcacagcacgccatcaaagcatggcccgctgacgtagactat
tatgcaattggtcgcagtaccgctttggcttttcatacgatcagcggcctgcaggtgacc
taccctcacgcgcatgaaaccagcgaagagttgataaaactggcgacattgcagcaaata
gcgggtaagcatgcgcttatcctccgagggaatcaggggcgcgagctgctgtcagaaacg
ctggcggcacgtggcgcgcaggtcacctatgcagagtgctatcaacgttgccaaaaacac
tatgacggcgccatcgaaggccgtcgctggcgcgatcgtaatattcacacgcttgtcgtg
accagcggtgagatgctgcatcagctgtattcgctgttccccgaggtcgatcgtgaggaa
tggctgctccgctgtcgactagtcgtcgtcagcgaacgtttggcttccctggccgccgat
cttggttggcagactattcaggtagccgatggtgccgataacgatgcgctgttgcgcgcg
ttatgttga

DBGET integrated database retrieval system