KEGG   Pantoea ananatis LMG 5342: PANA5342_p10326Help
Entry
PANA5342_p10326   CDS       T01728                                 

Gene name
yneI
Definition
(GenBank) aldehyde dehydrogenase
  KO
K08324  succinate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.24]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
plf00250  Alanine, aspartate and glutamate metabolism
plf00650  Butanoate metabolism
plf00760  Nicotinate and nicotinamide metabolism
plf01100  Metabolic pathways
plf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:plf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PANA5342_p10326 (yneI)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PANA5342_p10326 (yneI)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    PANA5342_p10326 (yneI)
Enzymes [BR:plf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     PANA5342_p10326 (yneI)
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     PANA5342_p10326 (yneI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh baeRF_family2
Motif
Other DBs
NCBI-ProteinID: CCF12057
Position
pPANA10:complement(300750..302120)
Genome map
AA seq 456 aa AA seqDB search
MTDFAVSRNPTTGDILASYPMQNASELEQALSTSAAAFKKWRKSSMASRVTVLRQLGHQL
REREPELTRMITLEMGKPVAQARAEILKCANLCDWYAEFGPAMLEDQPSQVPDAWQSFRP
IGVILAVMPWNFPFWQVLRGAVGMLLAGNTYLLKHAPNVMGSATLMAELFDATDLPKGGF
NLINVDNEGVSTAIKDDRIAAVAVTGSVRAGAAIAAQAGAALKKTVLELGGSDPFIVLAD
ADLDEAVKSAVTGRYQNTGQVCMAAKRFIIEASIAEAFEARFVEAVKALKIGDPLNEDTY
IGPMARADLRDELDQQVQASLREGARLVLGGEKIAGQGNYYAPTILSDVTSEMTAFRQEL
FGPVAAIAVARDAEHALEIANNSDFGLSATVWTGDEHMAARMSEELEVGAVFINGNGASD
PRVTIGGVKKSGYGRELSHFGVHEFCNVQTIWKNRR
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgactgactttgccgtgtcacgtaatccaaccacgggcgacattctcgccagctatccc
atgcagaacgcatctgaactggaacaggcattaagcaccagcgcggctgcgtttaaaaaa
tggcgaaaaagcagcatggcatcacgcgtaacggtgcttcgccagctcggtcatcagctt
cgtgaacgcgagcctgaactgacacgcatgattaccttagagatgggtaaacccgtggcg
caggcgagagcggagatcctgaaatgcgccaatctgtgtgactggtatgcagaatttgga
cctgcgatgctggaagaccagccatcacaggtacctgatgcgtggcagtcctttcgccca
ataggcgtaatactggccgtcatgccgtggaatttccccttctggcaggttctgcgcggc
gccgtaggcatgctgctggcgggtaacacctatctgcttaaacacgcgcccaacgtcatg
ggaagcgcaacgctgatggctgagttatttgatgcaaccgacctgccaaagggcggtttt
aatctgattaacgttgataacgaaggtgtctcaaccgctatcaaagatgatcgtattgct
gcagtcgcagtaacaggcagtgttcgggctggtgcagcgatcgcagcacaggcgggcgca
gcgttgaaaaagaccgtgctggaactgggcggatcagatcctttcatcgtgctggctgat
gcagacctcgatgaagcggtgaaatctgcggtgacaggccgttatcagaataccggacag
gtctgtatggcggctaaacggttcatcattgaggcatccatcgcagaggcatttgaggcc
cgttttgtagaggctgtcaaagcgcttaaaatcggcgatcctttgaatgaggacacctat
atcggcccaatggcccgcgccgatctgcgtgatgagctggatcagcaggtacaagccagc
ctgcgtgagggtgcccggttggtgttaggcggtgagaaaatagcagggcagggcaactat
tacgcccccaccatcctttcagacgtcaccagcgaaatgaccgccttccggcaagagctg
tttggtccggtagcggcgattgccgtggcccgggatgcggagcacgctctggaaatcgcc
aataacagcgactttgggctgagcgcgaccgtctggacaggcgatgagcatatggctgcc
cggatgagtgaagagctggaagtgggcgctgtgtttattaatggcaatggcgcttcagat
ccgcgcgtcaccattggtggtgtgaaaaagagtggctatggccgcgaactgtcacatttt
ggtgtgcatgagttctgtaatgtgcagacgatttggaaaaaccgtcggtaa

DBGET integrated database retrieval system