KEGG   Paucimonas lemoignei: NCTC10937_01740Help
Entry
NCTC10937_01740   CDS       T05492                                 

Gene name
ywrD_2
Definition
(GenBank) gamma-glutamyltransferase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
plg  Paucimonas lemoignei
Pathway
plg00430  Taurine and hypotaurine metabolism
plg00460  Cyanoamino acid metabolism
plg00480  Glutathione metabolism
plg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:plg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    NCTC10937_01740 (ywrD_2)
   00460 Cyanoamino acid metabolism
    NCTC10937_01740 (ywrD_2)
   00480 Glutathione metabolism
    NCTC10937_01740 (ywrD_2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:plg01002]
    NCTC10937_01740 (ywrD_2)
Enzymes [BR:plg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     NCTC10937_01740 (ywrD_2)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     NCTC10937_01740 (ywrD_2)
Peptidases and inhibitors [BR:plg01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   NCTC10937_01740 (ywrD_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: SQF97622
UniProt: A0A2X4CVK3
Position
1:1926596..1928206
Genome map
AA seq 536 aa AA seqDB search
MLKFSAHEYPYASQRQSVFARRGMVAASQPLAAQAGIEIMQKGGNAIDAAIATAAALTVV
EPTGCGIGGDAFALVWCKGQLHGLNGNGHAPAALSIEAVKAAGHAQMPMYGWTPVTVPGC
PSAWAELSQRFGKLPFAELLQPAISLARDGFPLSPVVAHQWQISLNEFGPHRDEVLQAWF
DTFLIDGRAPQAGEIFRNPAQARTLEELAATRCESLYRGALAERLDAHSRASGGYLRASD
LEGYRAQWVEPIHINYRGVDVWEIPPSGQGLVALMALKILEGFSFDHRDSQHTWHRQLEA
MKLAYSDGLHYITDPAHMRVAVADLLSDDYSTRRRGQIGEQALAPKPGDPHASGTVYLAT
ADAEGNMVSFIQSNYHGFGSGVVLPDSGIALQNRGQEFSLDEGHANCLAPGKKTFHTIIP
GFLSKDGKALGPFGVMGGYMQPQGHVQMVMNLVDFGLNPQAALDAPRWQWLGDMKVGIEH
GASRDLVNALARRGHKVQTDSDLTDYGRGQIILRDPVTGVLCGGTEPRADSHIAVW
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaattctccgctcacgaatacccctatgcgtcgcaacgccaaagcgtgtttgcc
cgtcgcggcatggtcgcggcgtcccagccgctggcggcccaggccggcatcgaaatcatg
cagaagggcggtaatgccatcgatgccgccatcgccacggcggcggcgctcaccgtcgtc
gaacctactggctgcggcattggcggcgacgcatttgccctggtgtggtgcaaggggcag
ttgcatggcctgaacggcaacggccacgcaccggcagccttgagtatcgaggcggtcaag
gcggctgggcatgcgcagatgccgatgtatggctggaccccggtcaccgtgccgggctgc
ccatcggcctgggccgagctgtcgcaacgcttcggcaaattgccgtttgccgagttgctg
cagcctgctatcagcctggcacgcgatggttttccgttgtcgccggtggttgcccatcaa
tggcagatctccttgaacgaattcggcccgcatcgcgatgaagtgctgcaagcctggttc
gacacctttctcattgatggacgcgcgccccaggcgggcgagattttccgcaacccggcc
caggcacgtaccctggaagaacttgccgccacccgctgcgaaagcctgtatcgcggcgct
ctggccgagcgcctggatgcgcattcgcgtgccagcggcggctacctgcgcgccagcgac
ctcgagggttatcgagcgcagtgggtggagccgatccacatcaattaccgtggtgtggat
gtctgggaaatcccgcccagcggccagggcctggtcgcattgatggcgctgaagatcctc
gaaggcttcagcttcgatcaccgcgacagccagcacacctggcatcgccaattggaagcc
atgaagctggcctacagcgatggcctgcactacatcaccgacccggcgcacatgcgtgtg
gcagtggccgacctgctcagcgacgactacagcacccgccgccgtggccagatcggcgag
caggccctggcgcccaaacccggcgaccctcacgccagcggtacggtgtacctggccacc
gcggatgccgaaggcaatatggtctcgttcatccagagcaactaccacggcttcggctcc
ggcgtggtgctgcccgacagcggcatcgccttgcagaatcgcgggcaggaattcagcctc
gatgaggggcatgccaactgcctggcgccgggcaagaaaaccttccacaccatcattccg
ggtttcctcagcaaggacggcaaagcccttggaccgttcggcgtgatgggcggctacatg
cagcctcagggccatgtgcagatggtgatgaacctggtggacttcggcctcaacccccag
gcggcattggacgcgccgcgctggcaatggctgggcgacatgaaggtcggcatcgaacat
ggagcttcgcgcgacctggtcaatgcgctggcgcggcgcgggcacaaggtgcagaccgac
agcgacctgaccgactacgggcgtgggcagatcatcctgcgtgacccggtcaccggcgtg
ttgtgcgggggcactgagccacgggcggattcgcatatcgcggtctggtga

DBGET integrated database retrieval system