KEGG   Paucimonas lemoignei: NCTC10937_01853Help
Entry
NCTC10937_01853   CDS       T05492                                 

Gene name
fadA_1
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
plg  Paucimonas lemoignei
Pathway
plg00071  Fatty acid degradation
plg00072  Synthesis and degradation of ketone bodies
plg00280  Valine, leucine and isoleucine degradation
plg00310  Lysine degradation
plg00362  Benzoate degradation
plg00380  Tryptophan metabolism
plg00620  Pyruvate metabolism
plg00630  Glyoxylate and dicarboxylate metabolism
plg00640  Propanoate metabolism
plg00650  Butanoate metabolism
plg00900  Terpenoid backbone biosynthesis
plg01100  Metabolic pathways
plg01110  Biosynthesis of secondary metabolites
plg01120  Microbial metabolism in diverse environments
plg01130  Biosynthesis of antibiotics
plg01200  Carbon metabolism
plg01212  Fatty acid metabolism
plg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:plg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NCTC10937_01853 (fadA_1)
   00630 Glyoxylate and dicarboxylate metabolism
    NCTC10937_01853 (fadA_1)
   00640 Propanoate metabolism
    NCTC10937_01853 (fadA_1)
   00650 Butanoate metabolism
    NCTC10937_01853 (fadA_1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NCTC10937_01853 (fadA_1)
   00072 Synthesis and degradation of ketone bodies
    NCTC10937_01853 (fadA_1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NCTC10937_01853 (fadA_1)
   00310 Lysine degradation
    NCTC10937_01853 (fadA_1)
   00380 Tryptophan metabolism
    NCTC10937_01853 (fadA_1)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NCTC10937_01853 (fadA_1)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NCTC10937_01853 (fadA_1)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NCTC10937_01853 (fadA_1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:plg04147]
    NCTC10937_01853 (fadA_1)
Enzymes [BR:plg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     NCTC10937_01853 (fadA_1)
Exosome [BR:plg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NCTC10937_01853 (fadA_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III Dodecin
Motif
Other DBs
NCBI-ProteinID: SQF97734
UniProt: A0A2X4A4U4
Position
1:2060185..2061390
Genome map
AA seq 401 aa AA seqDB search
MTDALIFDAVRTPRGKGKPDGALYSVKPVNLMAGLLTALQARNQLETAQVDDIVLGCVTP
VGDQGADIAKTAALVADWDVSVAGVQINRFCASGLEAVNLGAMKIRSGFEELVVVGGVES
MSRVPMGSDGGAWVLDPQTNMHCHFTPQGIGADLIATLEGFTRQDVDAYALQSQIKAARA
RQDGSFDRSLIPVRDQNGSLLLDHDEFIRADSTLEGLGKLKPSFAMIGQMGFDATALRVY
SHVERIDHVHTPGNSSGIVDGAAAMLIGSAAKGRALGLQPRGRIVATAVTGTDPTIMLTG
PAPATRKALSKAGLKLEDIDLFEVNEAFASVVLKFIKDLHVDPARVNVNGGSIAMGHPLG
ATGCMILGTLLDELHTRKLRYGLATLCVGGGMGIATIIERY
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgctttaatcttcgacgcggtccgtacgccgcgtggtaaaggcaagcctgat
ggggcgctctacagcgtcaaaccggtgaacctgatggcaggtctgctgacggctcttcaa
gcgcgtaaccagcttgagacggcgcaggtcgacgatatcgtgctcggttgcgtgacgccg
gtgggggatcagggtgcagacattgccaagacagcagcgctggtcgccgactgggacgtg
agcgtggcgggtgtgcagatcaaccgattctgtgcttccgggcttgaggcggtgaatctg
ggcgcgatgaaaattcgatccggcttcgaagaactggtggtggtcggtggggtggagtcc
atgtcccgagtgccgatgggcagtgacggcggggcatgggtactggatccgcagaccaat
atgcattgccacttcactccgcagggcattggcgccgacttgatcgcgaccctcgaaggg
ttcacccggcaggacgtggatgcttacgcgctgcaatcgcagatcaaggctgcccgggcg
cgtcaggacggctcgtttgatcgctcactgatcccggtgcgcgatcagaacggctcgttg
ctgctggatcatgacgagttcatccgcgccgactccaccctggaaggcctcggcaagctc
aagccgagtttcgcgatgattggccagatgggcttcgacgccactgcgttgcgggtctac
agccatgtggagcgtatcgaccacgttcacaccccgggcaacagctccggcatcgtcgat
ggcgccgccgccatgctcatcggctcagcagccaagggccgcgcgcttggtctgcagcct
cgtggccgcatcgttgccacggcggtgaccggtaccgacccgaccatcatgctgacggga
ccggccccggcgacgcgcaaggcattgagcaaggctggcctgaagcttgaagacatcgac
ctgttcgaggtcaacgaagcctttgcttcggtggtgctcaaattcatcaaggacctgcac
gtcgatcctgccagggtcaacgtcaatggcggttctatcgccatgggccatccgctgggc
gcaaccggttgcatgatcctcggcaccttgctggatgaactgcacacacggaaattgcgc
tacggcctggcgaccctgtgcgtcggcggcggtatgggtattgccaccatcatcgagcgt
tattga

DBGET integrated database retrieval system