KEGG   Paucimonas lemoignei: NCTC10937_01934Help
Entry
NCTC10937_01934   CDS       T05492                                 

Gene name
algA_1
Definition
(GenBank) mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase
  KO
K16011  mannose-1-phosphate guanylyltransferase / mannose-6-phosphate isomerase [EC:2.7.7.13 5.3.1.8]
Organism
plg  Paucimonas lemoignei
Pathway
plg00051  Fructose and mannose metabolism
plg00520  Amino sugar and nucleotide sugar metabolism
plg01100  Metabolic pathways
plg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:plg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    NCTC10937_01934 (algA_1)
   00520 Amino sugar and nucleotide sugar metabolism
    NCTC10937_01934 (algA_1)
Enzymes [BR:plg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     NCTC10937_01934 (algA_1)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     NCTC10937_01934 (algA_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MannoseP_isomer NTP_transferase NTP_transf_3 Cupin_2 AraC_binding
Motif
Other DBs
NCBI-ProteinID: SQF97814
UniProt: A0A2X4A524
Position
1:complement(2154162..2155619)
Genome map
AA seq 485 aa AA seqDB search
MSILIPCIIAGGAGTRLWPVSREAVPKPFMRLPDGESLLQKTFMRAVGLPDVQRLLTVTN
REVYFRTVDDYRQLNKGRIKLDFILEPFGRNTAPAVAAAALHVAQLYGDDAQLLILPADH
LIANGPAFAQAVQSARELADEGWMVTFGIVPGKPETGFGYIEKGQSLNNQAYQVARFVEK
PDATTAQAYVDGGLHLWNAGMFCMRADTLLREFETHAPEVLAAVKACLAQSSTKEGNQEL
QLELDGQSFANTPDISIDYALMERSQKVAVVPCNLGWSDIGSWQAVRELTGADDNGNQCN
GETVLHDVSNCYIDSPKRLVGGVGLDNLIIIDTPDALLIADGKRSQDVKFIAQELKRQGH
DAYRLHRTVTRPWGTYTVLEEGKRFKIKRIVVRPQASLSLQMHHHRSEHWIVVSGMAQVT
NGEREFMLDTNESTFIKPGHTHRLVNPGVIDLVMIEVQSGEYLGEDDIVRFTDIYGRVPA
ETTKA
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcctcatcccttgcattattgccggcggtgccggcacccgactctggccagtc
tcgcgcgaggccgtgcccaagccgttcatgcgccttcccgatggcgaaagcctgctgcaa
aaaaccttcatgcgcgccgttggcttacccgatgtacagcgtttgctgaccgtgaccaac
cgcgaagtgtatttccgcaccgttgatgactatcgccaactcaacaagggccgcatcaag
ctggactttatccttgagcctttcggccgcaataccgcacctgcggtggcggcggcagcg
ctccatgtcgcgcaactgtatggcgacgacgcgcaactgttgatcctccccgccgaccat
ctcattgccaacggcccggcctttgcccaggcggtgcaaagcgcccgtgaactggcggac
gagggctggatggtgaccttcggcatcgtgcccggcaagccagaaaccggctttggctac
atcgagaagggccagtcgctcaacaaccaggcgtatcaagtggcccgctttgtcgagaag
ccggatgccacaaccgcccaggcctacgtcgatggcggtttgcacctgtggaacgcgggc
atgttctgcatgcgagccgataccctgcttcgggaattcgagacccatgcgcccgaagtg
ctggccgccgtcaaagcgtgcctggcgcaaagctcgaccaaagaaggcaatcaggaactg
caactggagctggacggccagtcgttcgccaacacaccggacatttccatcgattacgcg
ttgatggaacgctcccagaaagtggccgtggtgccgtgcaacctgggctggagcgacatc
ggttcgtggcaggccgtgcgggaattgacaggcgcagacgacaacggcaaccagtgcaat
ggagaaacggtgctgcacgacgtcagcaactgctacatcgactcgcccaagcggctggtc
gggggcgtcggcctggacaacctgatcatcatcgacaccccggacgccttgctgatcgcc
gatggcaagcgcagccaggacgtgaagttcatcgcccaggaactcaagcgccagggccac
gatgcctatcgcctgcaccgtaccgtcacccgtccatggggcacgtacaccgtgctggag
gaaggcaaacgcttcaagatcaaacgcatcgtggtccgcccgcaggcatcgctgtccctg
cagatgcaccaccatcgcagcgaacactggatcgtcgtcagcggcatggcgcaggtcacc
aatggtgagcgcgaattcatgctcgacaccaacgagtcgaccttcatcaagccgggccac
acccatcggctggtcaatccgggagtgatcgacctggtgatgatcgaggtgcagagcggc
gagtacctgggcgaagacgacatcgtgcgctttaccgatatctatggccgggtgcctgcc
gaaaccaccaaggcctga

DBGET integrated database retrieval system