KEGG   Paucimonas lemoignei: NCTC10937_03882Help
Entry
NCTC10937_03882   CDS       T05492                                 

Gene name
phhA
Definition
(GenBank) phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
plg  Paucimonas lemoignei
Pathway
plg00360  Phenylalanine metabolism
plg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
plg00790  Folate biosynthesis
plg01100  Metabolic pathways
plg01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:plg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    NCTC10937_03882 (phhA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NCTC10937_03882 (phhA)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NCTC10937_03882 (phhA)
Enzymes [BR:plg01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     NCTC10937_03882 (phhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: SQF99720
UniProt: A0A2X4ADK3
Position
1:4308004..4308807
Genome map
AA seq 267 aa AA seqDB search
MSLTQYVAREPDAQGFIDYPDADHQVWNTLITRQMKVVEGRACQEYLDGIEQLALPHERI
PQLSEINKVLSVTTGWQVARVPALIPFQKFFELLANRQFPVATFIRTAQELDYLQEPDIF
HEIFGHCPLLTNPWFAEFTHTYGKLGLSASKEQRVYLARLYWMTIEFGLVDTAQGRRIYG
GGILSSPREAVYSLSSEPEHQAFDPIEAMRTPYRIDILQPLYFVLPDLKQLFDLAQQDIM
GMVEQATQLGLHPAKFPPKKPSSHQAA
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgagccttacccaatacgtggcgcgcgagcccgatgcacaggggttcattgattacccg
gacgccgatcaccaggtgtggaataccctgatcacccggcagatgaaggtagtggaaggt
cgcgcctgtcaggaatatctggacggcatcgagcagcttgccctgccacatgagcgcatc
ccgcaactgtccgaaatcaacaaggtgctgtctgtgaccacgggttggcaggttgcgcgg
gtaccggcgctgatcccctttcagaagtttttcgaactgctggccaaccggcagtttccc
gtggcgacgttcatccgcaccgcgcaagagctggactacctgcaagagccggacattttt
catgaaatcttcggccactgccctttgctgaccaacccctggttcgcggaattcacccac
acctatggcaagctgggcttgagtgccagcaaagaacagcgggtgtacctggcgcggctg
tactggatgaccatcgagttcggcctggtggatactgcgcaaggtcggcgaatctatggc
gggggcattctttcctcacccagggaagcggtgtacagcctgtccagcgagccggaacat
caggccttcgaccctatcgaggccatgcgcacgccttaccgtatcgatatcctgcaaccg
ctgtattttgtcttgcccgacttgaagcagctgtttgatctggcccagcaagacatcatg
ggcatggtcgagcaggccacgcagctgggtctgcatccagcgaaattccctcctaaaaaa
ccttccagccaccaggcggcctga

DBGET integrated database retrieval system