KEGG   Paucimonas lemoignei: NCTC10937_04225Help
Entry
NCTC10937_04225   CDS       T05492                                 

Gene name
argF
Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
plg  Paucimonas lemoignei
Pathway
plg00220  Arginine biosynthesis
plg01100  Metabolic pathways
plg01110  Biosynthesis of secondary metabolites
plg01130  Biosynthesis of antibiotics
plg01230  Biosynthesis of amino acids
Module
plg_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:plg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    NCTC10937_04225 (argF)
Enzymes [BR:plg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     NCTC10937_04225 (argF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N Pneumo_M2
Motif
Other DBs
NCBI-ProteinID: SQG00054
UniProt: A0A2X4ABB6
Position
1:4711558..4712478
Genome map
AA seq 306 aa AA seqDB search
MNPRHFLSMMDYKPEELLRLIRRGVELKDLRNRGVLFEPLKSRVLGMVFEKSSTRTRVSF
EAGMIQLGGQAIFLSPRDTQLGRGEPICDAARVLSSMLDGVMIRTFAHSNLLEFAAHSRV
PVINGLSDDLHPCQLLADMQTFLEHRGSIQGKTVAWIGDGNNMCNSYIEAAIQFDFQLRV
ACPAGYEPNPEFLALAGDRVTVLRDPRQAVAGAHLVSTDVWTSMGQEEETAKRVALFTPF
QVTRELLDLADPDVLFMHCLPAHRGEEISMDLLDDARSVAWDQAENRLHAQKALLEFLIA
PSCQPA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaaccccaggcactttctctcgatgatggattacaagccagaagagctcctgcgcttg
attcgtcgcggcgtagagctcaaagacctgcgtaatcgtggtgtacttttcgagccgctg
aaaagccgggtgctgggcatggtgttcgagaaatcttcgacacgtacccgtgtttcgttc
gaagccggcatgattcaactgggcggccaggcgatctttttgtccccacgagacactcaa
ctgggccgtggcgagccgatttgcgatgccgccagggtgctgtcgagcatgctcgatggg
gtgatgatccgtacctttgcccacagcaatctgctcgaattcgccgcccattctcgcgtg
ccggtcatcaacggtttgtcggacgacctgcacccctgccagttgctggccgacatgcag
accttccttgagcatcgcggctcgatccagggcaaaaccgttgcctggattggcgacggc
aacaacatgtgcaacagctatatagaagcggcgattcaattcgacttccagttgcgcgtc
gcttgcccggcaggttacgagccaaaccctgaattcctggcgctggccggtgatcgggtc
accgtgctgcgcgacccacgccaagccgttgcgggtgcacacctggtcagtaccgatgtc
tggacctccatgggccaggaagaagaaaccgccaagcgcgtcgccttgttcaccccgttc
caggtcacccgtgagctgctggatctggctgatccggacgttctgttcatgcattgcttg
ccagcccaccggggtgaagaaatcagcatggatctgctcgacgatgcccgctcggttgcc
tgggatcaggcggaaaaccgtctgcatgctcagaaagccctgctggagttcctgatcgca
ccgtcctgccagcctgcatga

DBGET integrated database retrieval system