KEGG   Paucimonas lemoignei: NCTC10937_04339Help
Entry
NCTC10937_04339   CDS       T05492                                 

Gene name
folM
Definition
(GenBank) short chain dehydrogenase
  KO
K13938  dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.50 1.5.1.3]
Organism
plg  Paucimonas lemoignei
Pathway
plg00670  One carbon pool by folate
plg00790  Folate biosynthesis
plg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:plg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NCTC10937_04339 (folM)
   00670 One carbon pool by folate
    NCTC10937_04339 (folM)
Enzymes [BR:plg01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     NCTC10937_04339 (folM)
    1.5.1.50  dihydromonapterin reductase
     NCTC10937_04339 (folM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase RmlD_sub_bind DOPA_dioxygen
Motif
Other DBs
NCBI-ProteinID: SQG00166
UniProt: A0A2X4AXI3
Position
1:4838194..4838883
Genome map
AA seq 229 aa AA seqDB search
MNNPILITGASQRVGLELATALAEAGHLVVNASRTLAPASSHPNIVSFAVDLQIAEERME
LVAWLQSNYSGLRAVIHNASLWLKDGVDNLNTMFKLHVEAPYHLNHELAPLLAQSPKADI
IHICDETSSRGSKSHIAYAATKAALQNMVLSFAEKLAPDIRVNAILPGLLILKENSDEAY
RNQTLKKALLEFEPGSQPLIDAVFYLLNTQYSTGSSVVVNGGRHLKKGA
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgaataatccaatcctgatcaccggggccagtcaacgagtgggtcttgagttggcaaca
gcactggccgaggccggccatctggttgtcaacgccagccgcaccctcgccccggcatcg
tcgcatcctaatatcgtgtcgtttgccgttgacctgcagatcgccgaagagcgcatggag
ctggtcgcctggttgcagtccaactactcagggctgcgggcggtgatccacaacgcatcg
ctgtggctgaaagacggcgtcgacaacctgaacaccatgttcaaactacatgtcgaagcg
ccctaccatttgaaccacgagctggcaccgctgctggcgcaaagcccgaaggcggacatc
atccatatctgcgatgagacctcctcccggggcagcaaaagccatatcgcctatgccgcg
accaaggccgcgttgcaaaacatggtgttgtccttcgcggaaaagctcgcgcctgatatc
cgggtgaatgcgatcctgccaggcttgctgatcctcaaggaaaacagtgacgaggcctat
cgcaaccagacgctgaaaaaggccctgctggagttcgagccaggctcgcagccattgatc
gatgcggtgttctatctgctcaatacgcagtacagcacaggcagcagtgtggtcgtgaac
ggcggccgacacctgaagaaaggcgcttga

DBGET integrated database retrieval system