KEGG   Paucimonas lemoignei: NCTC10937_04347Help
Entry
NCTC10937_04347   CDS       T05492                                 

Gene name
bsaA_3
Definition
(GenBank) putative glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
plg  Paucimonas lemoignei
Pathway
plg00480  Glutathione metabolism
plg00590  Arachidonic acid metabolism
plg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:plg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    NCTC10937_04347 (bsaA_3)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    NCTC10937_04347 (bsaA_3)
Enzymes [BR:plg01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     NCTC10937_04347 (bsaA_3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: SQG00174
UniProt: A0A2X4ABM2
Position
1:complement(4845952..4846434)
Genome map
AA seq 160 aa AA seqDB search
MSAFHDMKLKTLDGQELPLAPFKGQLVLVVNVASKCGLTPQYAALENLYQTYKSQGFNVL
GLPCNQFAGQEPGTQEEIREFCSLNYGVTFTLGDKLDVNGPQRHSLYRLLAGEGAEYPGD
ITWNFEKFLVGKDGRVLARFSPRTAPDDPAVIQAIEKALA
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcttttcacgacatgaaactcaaaactctggatggacaggagctgccgctggcg
ccgttcaaggggcaattggttctagtcgttaacgtcgcttcaaaatgcgggcttacgccg
caatacgccgcgctcgaaaacctctaccagacctataaaagccagggcttcaatgttctg
ggtctgccgtgtaatcagtttgccgggcaggaaccggggacgcaggaagagatccgggag
ttctgcagcctcaactatggcgtgaccttcacactaggcgacaagctcgacgtgaacggc
ccgcagcgtcactcgctgtatcggctgttggcgggtgagggcgcagagtacccaggcgat
atcacctggaacttcgaaaagtttctggttggtaaagacggccgtgtcctggcccgcttt
tcacctcgcaccgcgccggatgatccggcggtgatccaggcgatcgagaaagcgttggct
tga

DBGET integrated database retrieval system