KEGG   Paucimonas lemoignei: NCTC10937_04863Help
Entry
NCTC10937_04863   CDS       T05492                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
plg  Paucimonas lemoignei
Pathway
plg03010  Ribosome
Brite
KEGG Orthology (KO) [BR:plg00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    NCTC10937_04863 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:plg03011]
    NCTC10937_04863 (rplV)
Ribosome [BR:plg03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    NCTC10937_04863 (rplV)
  Bacteria
    NCTC10937_04863 (rplV)
  Archaea
    NCTC10937_04863 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: SQG00667
UniProt: A0A2X4B0K3
Position
1:complement(5459421..5459753)
Genome map
AA seq 110 aa AA seqDB search
MEVAAKLSGARISAQKTRLVADQIRGKKVGEALNLLAFSNKKAAEILKKVLESAVANAEH
NEGADVDDLRVSTVFVNEGRSLKRIMPRAKGRADRIVKRSCHITVKVADK
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaagtagccgctaagctgtcgggcgctcgaatctccgcccagaaaacccgcttggtc
gccgaccagatccgcgggaagaaggtgggcgaagcgctcaacctgttggctttcagcaac
aagaaagctgccgagatcctgaagaaagtgctggagtcggctgtagccaacgccgagcac
aacgaaggcgcagacgtagatgacctccgggtctccaccgttttcgtcaacgaagggcgt
tcgctgaagcgcatcatgcctcgtgccaaaggccgggctgatcgcatcgtcaagcggtct
tgccatatcactgtcaaggttgctgacaagtaa

DBGET integrated database retrieval system