KEGG   Paucimonas lemoignei: NCTC10937_04939Help
Entry
NCTC10937_04939   CDS       T05492                                 

Gene name
apaG
Definition
(GenBank) ApaG protein
  KO
K06195  ApaG protein
Organism
plg  Paucimonas lemoignei
Brite
KEGG Orthology (KO) [BR:plg00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    NCTC10937_04939 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 LuxE
Motif
Other DBs
NCBI-ProteinID: SQG00731
UniProt: A0A2X4D0Z9
Position
1:5535450..5535830
Genome map
AA seq 126 aa AA seqDB search
MSDSRYQVDVSVVTRFLVEQSQPEHNRFAFAYTVTVHNSGELPAKLLSRHWVITDGDGHV
EEVRGEGVVGQQPLIDAGQSHTYSSGTVMTTKVGNMQGTYQMLAEDGKRFDAVIAPFRLA
VPGSLH
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgtccgattcccgatatcaggtcgacgtcagcgtcgtcacacgcttcctcgtcgagcag
tcccaacccgagcacaatcgctttgcgtttgcctacaccgtgactgtgcataacagtggc
gagctgcctgccaaacttctttcgcggcattgggtgatcaccgacggtgacggccacgta
gaagaggtgcgaggcgaaggcgtagttggccaacagcccctgatcgacgcaggtcagagc
cacacctacagcagcggcacggtgatgaccaccaaggtcggcaacatgcagggcacctat
cagatgctcgccgaagacggtaagcgcttcgatgctgtcattgcaccgtttcgcctggcg
gtgccggggtcgcttcactga

DBGET integrated database retrieval system