KEGG   Planctomyces sp. SH-PL62: VT85_16915Help
Entry
VT85_16915        CDS       T04401                                 

Definition
(GenBank) Carbohydrate binding domain protein
Organism
plh  Planctomyces sp. SH-PL62
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_129 CBM_4_9
Motif
Other DBs
NCBI-ProteinID: AMV39122
UniProt: A0A142YJB0
Position
4302337..4304712
Genome map
AA seq 791 aa AA seqDB search
MRAALRLLLSIILITYLSPSSTRAQVEPSGPSRAESRDAANPLVGWSPFWARSEGAGTAV
VDPAVRREGRDTIRVEQKGPRDWSLSREQTIEVKPGQIHRLSAWFKVAEGSRAVLSVVLR
DEGDRVLEWSYGERIAVAPEWDRVEARFMIPPGAKTMQPRVIGDGPARFWIDDLSLTLDP
DSLVIGAKPSTESLELADARLRVVVDPTNGAFRVRDARSGREWSQPSNGSGLVILGAKRE
SNQILIDFVDPRSIMKFRASVRIDPDPSEIVVELTGQGPLASPIAFPYPFVTGDGTTLIL
PVNEGMSYPVDDPSLPPMEFILYGGHGLCMAWWGVVDGQAGLMAIVETPDDASVRVPRSE
GKLCLAPLWEPQKGRFGPTRRIRYIFFEDGGYVAMAKRYREYARSTGLLKTLVQKRAENP
NIDKLVGAANIWCWDRDPVAIVRELKEAGIDRILWSNAATPEQLRKLNQLGVLTSRYDID
QDVMDPATFPRLPDVHPDWTTKAWPEDLMLDARGNWIRGWEVEGKDGRMYACGVTCDRQA
VSYAVKRIGEELRTHPYQSRFIDTTTASPWRECYSPTHPVTRSESRRFKMDLLGVVHDRY
KLITGSETGHDAAVPFADYFEGMLSLGPYRVADAGRDMARIVKEVPPQIEKFQTGAYYRL
PLWELVFHDCVVAHWYWGDYNNKLPAVWARRDLFNALYGTPPMFMFTADSWRRDRDRFVE
SYRTATRVARESGYSEMLSHEWLTPDHSVQRTRFADGQVVVVNFGDQPYRTSEADLVSPL
GVLIHSRGETP
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atgcgagcggccttgcgccttctcctgtccatcattctgattacctatctctcgccgtcg
tcgacccgggcccaggtagagccctcggggccgtctcgcgccgaatcaagggacgcagca
aacccgctagttggctggagtcctttctgggcgcgatccgagggagcgggaaccgccgtc
gtcgacccggcggtgcgacgcgagggtcgtgacaccatacgagtggagcagaaggggccc
cgagattggagtctcagccgggagcaaacgatcgaggtgaagcctgggcagatccatcgc
ctctcagcttggttcaaggtggccgagggctcgcgtgctgttctctccgtggtgcttcgc
gacgagggggaccgcgttctggagtggtcctatggcgagagaatcgcggttgcgccggaa
tgggatcgggtcgaggctcggttcatgatcccgcctggtgcgaagaccatgcaaccgcgc
gtcatcggcgacgggccggcgagattctggatcgacgatctctccctgacgcttgatccg
gattcgctcgtcatcggtgcgaagcctagcacggaatcccttgaactggccgacgcgcgg
cttcgggtcgtcgtcgacccgaccaacggcgcgttccgcgttcgagacgctcgatcgggt
cgtgagtggtcgcagccctctaacggctctggcctcgtcatactcggtgcgaagcgagaa
tccaaccagatcctgatcgatttcgtcgaccctcgctcgatcatgaaattccgggcgagt
gtgcgaatcgatcctgatccatcggagatcgtcgtcgaattgacgggccagggaccgctc
gcctccccgatcgcgtttccgtacccgttcgtcactggcgacggcacaacgctgatccta
cccgtgaacgaagggatgagctacccggtcgacgacccgagccttcccccgatggagttc
atcctctacggcggccatgggctctgcatggcctggtggggggtcgtcgatggacaggcc
ggattgatggcgatcgtcgagacccccgacgacgcttcggtccgcgtgcctcggtccgaa
gggaagctctgcctcgccccactctgggaaccgcagaagggccggttcgggccgacgcgt
aggatccgatacatcttcttcgaggacggcggatacgtcgcgatggccaagcgctatcgc
gagtatgccaggtccacagggctcctgaagacactcgtccagaagcgggccgagaatccg
aacatcgacaaactggtcggcgccgctaacatttggtgctgggaccgcgaccccgtggcg
atcgtaagagaactcaaggaggcggggatcgaccgaattctctggtcgaacgccgctact
cccgagcaactccggaagctcaaccagttaggggttctcacgagccgttacgacatcgat
caggacgtgatggacccggcgacattccccaggctcccggacgtccaccccgattggacg
accaaggcctggcctgaagacctgatgctcgatgctcggggaaactggatccgaggctgg
gaagtcgagggtaaggacggccggatgtacgcctgcggcgtcacctgcgatcgacaggcc
gtaagttacgcagtgaagcggatcggcgaagagttgaggacgcacccctatcagtcgcgg
ttcattgacacgactactgcatcgccgtggcgggaatgctactcccccacgcatcccgtc
acacggtccgagagccgtcgtttcaagatggacctgctcggcgtggtccacgaccggtac
aagctgatcaccggctccgagacgggccacgacgccgccgtcccgttcgccgactacttt
gaaggcatgctcagcctgggcccctatcgcgtcgcggacgccggccgggacatggcgaga
atcgtgaaggaagtcccgccccagatcgaaaagttccagaccggagcatactaccgattg
ccgctctgggagttggtcttccacgactgcgtcgtcgcgcattggtactggggcgactac
aacaacaagctccctgcggtctgggctcgtcgcgatctcttcaacgcactgtacggcaca
ccacccatgttcatgttcacggccgattcctggcggcgagaccgcgatcgcttcgtggaa
agctatcgcaccgcgacccgcgtggcccgggaatcgggctacagcgagatgctctcgcat
gaatggctgacacccgatcactccgtccagcgaacgcggttcgccgacgggcaagtcgtc
gtcgtgaatttcggcgaccagccctaccgcacttcagaagctgacctcgtttcgccgctg
ggcgttcttatccattcgcgtggcgagacgccttga

DBGET integrated database retrieval system