KEGG   Planctomyces sp. SH-PL62: VT85_20320Help
Entry
VT85_20320        CDS       T04401                                 

Gene name
ltaA
Definition
(GenBank) L-allo-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
plh  Planctomyces sp. SH-PL62
Pathway
plh00260  Glycine, serine and threonine metabolism
plh01100  Metabolic pathways
plh01110  Biosynthesis of secondary metabolites
plh01120  Microbial metabolism in diverse environments
plh01130  Biosynthesis of antibiotics
plh01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:plh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VT85_20320 (ltaA)
Enzymes [BR:plh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     VT85_20320 (ltaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 Cys_Met_Meta_PP Aminotran_3 Methyltrans_RNA
Motif
Other DBs
NCBI-ProteinID: AMV39790
UniProt: A0A142YLN1
Position
complement(5188720..5189787)
Genome map
AA seq 355 aa AA seqDB search
MSRPPIDLRSDTVTRPTPAMRRAMAEAEVGDDVYGEDPTIRALEARTAALLGKEAAVFTP
SGTMANQIAVGLHTRPGDELLCAESSHLYLWEAGGIARHWGVTARTFPGDAGLLRLADIE
DEVRPDDLHMVRTRLVALENTHNRGGGRVHPIEDVTAVSRWAKGEGLARHLDGARLMNAV
VASGVPADEWGSWFDTVSICFSKGLGAPVGSALAGTAEAMDRARKLRKFLGGAMRQAGIL
AAGALYALDHHVDRLAEDHAHARLLADVFEEVEGLALEFDGVETNLVWVAVDPELGTADD
IAAHLKSHGVLVAALGPQTIRACTHLDVSRADVQRAAEAIRTITPEALAAETVVY
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgagccgaccgccgatcgacctccggtccgacaccgtgaccaggccgacccccgcgatg
cgccgggcgatggcggaggccgaggtcggcgacgacgtctacggcgaggacccgacgatc
cgggcgctggaggcccggacggccgcgctgctcggcaaggaagcggccgtgttcacgccc
tcgggcacgatggccaaccagatcgccgtgggcctccacacccggcccggcgacgaactc
ctttgcgcggagtcttcccacctctacctgtgggaggccggcgggatcgcccgtcactgg
ggcgtcacggcccggaccttccccggcgatgcgggcctgctcaggctggcggatatcgag
gacgaggtgcggcccgacgacctgcacatggtgcgcacccggctggtcgccctggagaac
acccacaaccggggagggggccgggtccacccgatcgaggacgtgacggccgtctcgcgg
tgggcgaagggggagggcctggcgaggcacctcgacggcgcccggctgatgaacgccgtg
gtcgcttcgggggtcccggcggacgagtggggaagctggttcgacacggtctcgatctgc
ttctccaagggcctcggcgcgccggtgggctcggccctggccgggacggccgaggcgatg
gaccgggctcgcaagctccgcaaattcctgggaggcgcgatgcgccaggcgggaatcctg
gcggccggggccctgtacgcgctcgaccaccacgtcgatcggctggccgaggaccacgcc
cacgcccggctgctcgccgacgtcttcgaggaggtggaggggctggccctggagttcgac
ggcgtggagacgaacctggtctgggtcgcggtcgatcccgagctggggaccgcggacgac
atcgccgcccacctgaaatcgcacggcgtcctggtggccgcgctgggcccgcaaaccatc
cgggcctgcacccacctggacgtctcccgcgccgacgtgcaacgcgccgccgaggcgatc
cgcaccatcaccccggaggccctcgcggccgagaccgtcgtctactga

DBGET integrated database retrieval system