KEGG   Purpureocillium lilacinum: VFPFJ_01793Help
Entry
VFPFJ_01793       CDS       T05029                                 

Definition
(RefSeq) delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial precursor
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
plj  Purpureocillium lilacinum
Pathway
plj00250  Alanine, aspartate and glutamate metabolism
plj00330  Arginine and proline metabolism
plj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:plj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VFPFJ_01793
   00330 Arginine and proline metabolism
    VFPFJ_01793
Enzymes [BR:plj01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     VFPFJ_01793
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 28883926
NCBI-ProteinID: XP_018181351
UniProt: A0A179HRY1
Position
Unknown
AA seq 580 aa AA seqDB search
MAIPRLATARIARSARVSVPGLQNSRAYLQLRTKTTAPFRLPDERNEPNLDYRRGSLERQ
KVEEALTRMRSSLPLKSQIHYSGRAQEAPRSLDQVLPAEHGTVFTNYPLASRAQVADAIA
AALAAKRDWENTPFVDRAAVFLRAAELVAGKYRYELVAATMLGQGKNVWQAEIDAAAELA
DFFRLHCNYAADILGRQPTRGSDGIWTRTEYRPLEGFVYAVSPFNFTALGGSLVSAPALM
GNVVLWKPSQYNIYASAIVYKILLEAGLPQDVIQFVPGDAVEVTDEVLAHRDFAGLNFIG
SSDVFRSIYARIGQGIGNKTYREFPRVVGETSGKNFHLLHPSADIPSAVNHTIRGAFEYQ
GQKCSATSRVYVPQSRAAEFISGLKAGVEKITIGSPEKEFEAFMGPVIHKNSFDKIKSII
DAGNKDPSLKLLAGGTYDGSVGYYVNPTVYQAQSPDHKLFNQEIFGPVLALYVYKDEDWS
SMLKSVDENGGGLALTGAVFATDRKAIREAEDTLRYSSGNFYINCKTTAALIGQQTFGGA
RASGTNDKAGSPDVLRRFTSPRTIKEEFSPLDRFTYPSNE
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atggcaatccctaggctcgccactgcgcgaatcgcgcgaagtgcccgtgtctccgtcccc
ggcctgcagaactcccgagcgtacctgcagctgcgaaccaagacgacggcgccgtttcgt
ctccccgacgagcgcaatgagcccaatctagactaccgccgcggctccctcgagcgtcaa
aaggtcgaggaggcgctcacccgcatgcgctcctccctcccgctcaagagccaaatccac
tacagcgggcgcgcccaggaagcgccgcgctccctggaccaggtcctccccgcggagcac
ggcaccgtcttcacaaactatccgcttgcctcgcgcgcgcaggtcgccgacgccatcgcc
gccgcgctcgccgccaagcgcgactgggagaacacgccgttcgtagaccgcgcggccgtg
ttcctccgcgctgcggagctcgttgccggcaagtaccggtacgagctcgtggctgcgact
atgcttggccagggcaagaacgtgtggcaggcggagattgatgctgcggccgagctggcc
gactttttcaggctgcactgcaactacgccgccgacatcctgggcaggcagccgacgcgc
ggatcagacggcatctggacgcgcaccgagtatcgcccactcgaagggttcgtctacgcc
gtatcgccattcaatttcacggctcttggtggcagcctcgtttcggcacccgctctcatg
ggcaacgtcgtgttgtggaaaccgtcacagtacaacatctacgccagcgcgatcgtctac
aagatcctcctcgaggcagggctgccccaggacgtgatccagttcgtcccaggcgacgcc
gtcgaggtcacggacgaggtccttgcgcaccgcgactttgccgggcttaacttcatcggc
tcttcggacgtgttccggtctatctacgccaggatcggccagggcatcggcaacaagaca
taccgcgagttcccccgcgtcgtgggcgagacgagcggcaagaacttccacctgctccat
ccgtcagccgacatccccagcgccgtgaaccacaccattcgcggcgcctttgaatatcaa
ggacaaaagtgctctgccacgtcgcgcgtctacgtgccgcagtcgcgcgctgccgagttc
atctccggcctcaaggcaggggttgagaagatcaccatcggaagccccgagaaggagttt
gaggcgttcatgggtcccgttatccacaagaactccttcgacaagatcaagtccatcatt
gacgctggcaacaaggacccctcgctgaagctgctggccggtggcacgtacgacggttcg
gtcggctactacgtgaaccccaccgtgtaccaggcgcagtctccggaccacaagctcttc
aaccaagagattttcggtcccgtgctggcgctctacgtgtacaaggatgaggactggagc
tcgatgctgaagagcgtggatgagaacggaggtggacttgcgctgacgggcgccgtcttt
gctacggatcgcaaggccatacgagaggccgaagacactcttcgctactcatccggaaac
ttctacatcaactgcaagaccacggcggccctgatcggccagcagacgtttggcggtgct
cgggcgagcggcacgaacgacaaggcgggtagcccggatgttttgaggcggttcacaagc
ccgcggaccatcaaggaggagtttagcccgctggatcggttcacctaccctagtaatgag
tag

DBGET integrated database retrieval system