KEGG   Purpureocillium lilacinum: VFPFJ_02751
Entry
VFPFJ_02751       CDS       T05029                                 

Definition
(RefSeq) nitrite reductase
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
plj  Purpureocillium lilacinum
Pathway
plj00910  Nitrogen metabolism
plj01100  Metabolic pathways
Module
plj_M00531  Assimilatory nitrate reduction, nitrate => ammonia
plj_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:plj00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    VFPFJ_02751
Enzymes [BR:plj01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     VFPFJ_02751
SSDB
Motif
Pfam: Pyr_redox_2 NIR_SIR Pyr_redox Fer2_BFD NIR_SIR_ferr Rieske_2 Rieske Rubredoxin_C Amino_oxidase NAD_binding_7 ANAPC1
Other DBs
NCBI-GeneID: 28884883
NCBI-ProteinID: XP_018182308
UniProt: A0A179GLA5
Position
Unknown
AA seq 1156 aa
MAQIPNAKRVVVVGLGMVGIAFIEKLLKYDARTREYNITVLGEESHLAYNRVGLTSFFEH
RKIENLYLNPAEWYTSAPKDALGYLVNTKVVAIDSANKTVTCANGDVVPYDILVLATGSD
AILPRHTPGHDAKGVFVYRTIDDLVNLIDFAGTRKDSVGAVVGGGLLGLEAAKAMMDLES
FAQVKLIERNKWVLSRQLDEDAGTMVVQQVRDLGLDVKLSKRVKSIKVDGDNSVSGVVFE
DGEEMDCSTICFAIGVRARDDLALSSGLECAERGGGIVVGDDLATSQPDIYAIGECASWQ
GQTFGLIAPGVEMADVLAFNLTQAKLHSPRAFKRPDLSTKLKLLGVDVASFGDFFADRDG
PKHLPPKYTRKLKASAGPEAAPETPTVKTLTYKDPFQNVYKKYLFTADGKYLLGGMMIGD
TKDYVKVVPMVKNMKELETPPSQLILGAQKEGDDGDDLDDDTQICSCHNVTKGDVVNSVK
DGTCKDLASIKSCTKAGTGCGGCMPLVTTIFNKTMAAMGNEVKNHLCAHFSHSRAELYHI
VMVKRLTTLRDVMREAGNDAASAGCELCKPAVGSILASLWNRHVMDRPTHGLQDTNDRFL
GNIQRDGSYSVVPRVPGGEITPERLVVIGEVAREFGLYTKITGGQRIDMFGARKQDLPAI
WGRLVAAGMESGHAYAKSLRTVKSCVGSTWCRFGIGDSVGMAVRLEERYKSVRAPHKIKG
GVSGCVRECAEAQSKDFGLIATEKGFNIFVAGNGGAKPRHAELLAKDVLPADVVPILDRY
LMFYIRTADKLQRTAPWLESLPGGLKYLQEVVLEDKLGICASLEAQMEELVGSFFDEWAE
AIKTPALAAKFRQFHNSDARVDGVEAERERGQSRPVYWAKEAATDDFKGLRGRWSRTDWE
PVIEASYFDGADELPNGISANIKRGDTQLAVWRFKGRFYATQQMCPHKRAFVLSDGLLGQ
SPCDKKDGGKRQDDESLPPTPSSSSSASSASDTSPPTPASLASTLTSLSSSSTTPSSTTT
TTTTTSQSQTSPWISCPHHKRNFDLGNGSCSTDTSLSIATFDAEARPDGMLYLRLPPTEE
LDAALGTSRWMVRKGESGEAPFAELDRRTAAAAAALGKRGRKPNAVKAGPGSAGTKMVKP
VELMAGGGGCGSAPEW
NT seq 3471 nt   +upstreamnt  +downstreamnt
atggcccaaataccaaacgcaaagagagtggtggtggtgggcttgggcatggtgggcatc
gccttcatagagaaactgctcaagtacgatgcccgaacgcgagagtacaacatcacagtc
ctgggcgaggagtcgcatctggcgtacaaccgagtcggcctgacgagcttcttcgagcac
cgcaagattgagaatctgtacctgaacccggcagaatggtatacgagcgccccgaaagac
gccctcggatatcttgtcaacaccaaagtagtagcaatcgactcggcgaataagacagtc
acctgcgccaacggcgatgtcgtgccctacgacatcctcgtgctcgccacgggatccgac
gcgatcctcccgcggcacacgcccggacacgacgccaagggcgtgttcgtctacagaacc
atcgacgacctggtcaacctcatcgactttgccggcacgaggaaagactccgtcggggcg
gtcgtcggcggcggcctgctaggtctggaggcggccaaggccatgatggacctcgagtcg
tttgcacaggtcaagctcatcgagcgcaacaagtgggtgctcagccggcagctggacgag
gacgcgggcaccatggtcgtgcagcaggtcagggacctcggcctggacgtgaagctcagc
aaacgcgtgaagagcatcaaggtggacggcgacaacagcgtgagcggcgtcgtcttcgag
gacggcgaggagatggactgctcgaccatttgcttcgccatcggcgtccgcgcgagggac
gatctggccctcagctcgggcctcgagtgcgcggagcgcggcggcggcatcgtcgtcggc
gacgacctcgccacgagccaaccggacatttacgccattggcgagtgcgcgagctggcag
ggccagacgtttggcctcatcgccccgggcgtggaaatggccgacgtcctcgccttcaac
ctgacgcaggccaagcttcactcgccgcgggcctttaagcgcccggacctcagcaccaag
ctcaaactgctcggcgtcgacgtcgccagctttggagactttttcgccgaccgggacggg
ccgaagcacctgccgcccaagtacacaaggaaactgaaggccagcgcaggccccgaggcg
gcgcccgagacaccaacagtcaagaccctcacctacaaggacccgttccaaaacgtctac
aaaaagtacctcttcacggcggacggcaagtacctgctcggaggcatgatgattggcgac
accaaggactacgtcaaggtggtgcccatggtcaagaacatgaaggagctcgagacgccg
ccgagccagctcatcctcggggcgcaaaaggagggcgacgacggggacgacctcgacgac
gacacgcaaatctgctcgtgccacaacgtgaccaagggcgacgtggtcaacagcgtcaag
gacggcacgtgcaaggacctcgcgtccatcaagtcgtgcaccaaggcgggcacggggtgc
ggcgggtgcatgccgctggtgacgaccatcttcaacaagaccatggcggccatgggcaac
gaggtcaagaaccacctgtgcgcgcacttcagccactcgcgcgcggagctgtaccacatc
gtcatggtgaagcggctgacgacgctgcgcgacgtgatgcgcgaggcgggcaacgacgcc
gccagcgcgggctgcgagctgtgcaagcccgccgtgggcagcatcctggcctcgctctgg
aaccgccacgtcatggaccgcccgacgcacggcctgcaggacaccaacgaccgcttcctc
ggcaacatccagcgcgacggcagctactcggtcgtgccgcgcgtgcccggcggcgagatc
acccccgagcgcctcgtcgtcatcggcgaggtggcccgcgagttcggcctctacaccaag
atcacgggcggccagcgcatcgacatgtttggcgcccgcaagcaggacctgcccgccatc
tggggccgcctcgtcgccgcgggcatggagtcgggccacgcctacgccaagtcgctgcgc
accgtcaagagctgcgtcggctcgacctggtgccgcttcggcatcggcgacagcgtcggc
atggcggtgcgcctcgaggagcggtacaagagcgtgcgcgcgccgcacaagatcaagggc
ggcgtgagcggctgcgtgcgcgagtgcgccgaggcgcagagcaaagacttcggcctcatc
gccacggaaaagggcttcaacatcttcgtcgcgggcaacggcggcgccaagccccgccac
gccgagctgctggccaaggacgtgctgcccgccgacgtggtgcccatcctggaccgctac
ctcatgttctacatccgcacggccgacaagctgcagcgcacggcgccctggctcgagagc
ctgcccggcgggctcaagtacctgcaggaggtggtgctcgaggacaagctgggcatctgc
gcgtcgctcgaggcgcagatggaggagctcgtgggcagcttcttcgacgagtgggccgag
gccatcaagacgccggccctggccgccaagttccgccagttccacaactcggacgcgcgc
gtcgacggcgtcgaggccgagcgcgagcgcggccagagccgccccgtctactgggccaag
gaggccgccaccgacgacttcaagggcctgcgcggccgctggagccgcacagactgggag
cccgtcatcgaggcctcgtactttgacggcgccgacgagctgcccaacggcatctcggcc
aacatcaagaggggggacacgcagctcgccgtgtggcgtttcaagggccgcttctacgcc
acgcaacagatgtgcccgcacaagcgcgcctttgtcctctccgatggcctcctcgggcag
agcccgtgcgacaaaaaggatggcgggaagcgtcaggacgacgagtccctgccgcccacg
ccatcctcctcctcctcagcatcatcagcatccgatacatcgccgccaacaccggcctca
ctggcatcaacactcacatcactatcctcctcatcaacaactccctcctccactaccacc
accaccaccaccacgtcgcaatcacaaacgtcgccgtggatctcgtgcccgcaccacaag
cgcaacttcgacctcggcaacggctcctgcagcaccgacacctccctctccatcgccacg
ttcgacgccgaggcccgcccggacggcatgctgtacctgcggctgccgcccacggaggag
ctggacgcggcgctgggcacgagccggtggatggtgcgcaagggcgagagcggcgaggcc
ccctttgcggagctcgaccgccggaccgccgccgccgccgccgccctcggcaagaggggc
aggaagcccaacgccgtcaaggccgggccggggagcgcgggcaccaaaatggtgaagccc
gtggagctcatggctggaggagggggctgcgggtcggcgcccgagtggtga

DBGET integrated database retrieval system