KEGG   Purpureocillium lilacinum: VFPFJ_03530Help
Entry
VFPFJ_03530       CDS       T05029                                 

Definition
(RefSeq) 6-phosphogluconate dehydrogenase
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
plj  Purpureocillium lilacinum
Pathway
plj00030  Pentose phosphate pathway
plj00480  Glutathione metabolism
plj01100  Metabolic pathways
plj01110  Biosynthesis of secondary metabolites
plj01130  Biosynthesis of antibiotics
plj01200  Carbon metabolism
Module
plj_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
plj_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:plj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    VFPFJ_03530
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    VFPFJ_03530
Enzymes [BR:plj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     VFPFJ_03530
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     VFPFJ_03530
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 6PGD NAD_binding_2 NAD_binding_11
Motif
Other DBs
NCBI-GeneID: 28885661
NCBI-ProteinID: XP_018180509
UniProt: A0A179HQU4
Position
Unknown
AA seq 493 aa AA seqDB search
MSGPVADLGLIGLAVMGQNLIMNMADHGFTICAFNRTVSKVDRFLENEAKGKSIVGAHTV
EEFVSKLKSPRRVMLLVQAGAAVDDWIAKLVPLLSKGDIIIDGGNSHFPDSNRRTQELLA
KGIRFVGSGVSGGEEGARYGPSLMPGGNEEAWPHIKDIFQSIAAKSDGEACCEWVGDEGA
GHYVKMVHNGIEYGDMQLICEAYDIMKRGLGLSSKEIGDVFAKWNKGVLDSFLIEITRDI
MYYNDDDGKPLVDKILDKAGQKGTGKWTAVNALDLGMPVTLIAEAVLSRCLSAIKDERVQ
ASSKLEFVSRNNGKFSGDKAQFLEDLEQALYASKIISYAQGFMLMQEAAREYKWKLNKPS
IALMWRGGCIIRSVFLKDITAAYRKQPELTNLLFDDFFNKAIHKAQPGWRDVVAQSAQLG
IPTPAFSTALSWFDGYRTKDLPANLLQAQRDYFGAHTFRIKPEFASSKYPEGQDIHVNWT
GRGGNVSASTYQA
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgtctggccccgtcgctgatctgggcctcatcggccttgctgtcatgggacagaacctc
atcatgaacatggccgaccacggtttcaccatctgcgccttcaaccgaaccgtctccaag
gtcgaccggttcctggagaacgaggccaagggcaagtccattgtcggcgcccacactgtc
gaggagttcgtcagcaagctcaagtctccccgccgcgtcatgctgctcgtccaggccggc
gctgccgtcgacgactggattgccaagctcgtccctctcctgtccaagggagacatcatc
atcgatggtggcaactcccacttccccgactccaaccgccgcacccaggagctcctggcc
aagggcatccgcttcgtcggctccggtgtctccggtggtgaggagggtgcccgctacggc
ccctccctcatgcccggcggtaatgaggaggcctggccgcacatcaaggacatcttccag
agcatcgccgccaagagcgacggtgaggcctgctgcgagtgggtcggtgacgagggtgct
ggtcactacgtcaagatggttcacaacggcatcgagtacggtgacatgcagctcatctgc
gaggcctacgacatcatgaagcgtggcctcggtctctccagcaaggagattggtgacgtc
ttcgccaagtggaacaagggcgttctggactcgttcctcatcgagatcacccgcgacatc
atgtactacaatgacgacgatggcaagcccctcgtcgacaagatcctggacaaggccggc
cagaagggtaccggcaagtggaccgccgtcaacgccctggatctcggcatgcccgtcacc
ctgattgccgaggccgtcctgtcccgctgcctgtccgccatcaaggacgagcgcgtccag
gcctcgtccaagctcgagttcgtcagccgcaacaacggcaagttctctggcgacaaggcg
cagttcctcgaggacctcgagcaggccctctacgcctccaagattatctcgtacgcccag
ggcttcatgctcatgcaggaggccgcccgcgagtacaagtggaagctcaacaagccctcc
atcgccctcatgtggcgtggtggctgcatcatccgctccgtcttcctcaaggacatcacg
gccgcttaccgcaagcagcccgagctgacgaacctgctgttcgacgacttcttcaacaag
gccatccacaaggcccagcccggctggagagacgtggtcgcccagtctgctcagctgggt
atcccgacacccgccttctcgacggcgctgtcgtggtttgacggctaccgcaccaaggac
ctgcccgccaacctgctccaggcccagcgtgactactttggtgcccacaccttccgcatc
aagcccgagtttgccagcagcaagtaccccgagggccaggacatccacgtcaactggacc
ggccgtggcggcaacgtctctgcctcgacgtaccaggcttaa

DBGET integrated database retrieval system