KEGG   Purpureocillium lilacinum: VFPFJ_05387Help
Entry
VFPFJ_05387       CDS       T05029                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
plj  Purpureocillium lilacinum
Brite
KEGG Orthology (KO) [BR:plj00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:plj01001]
    VFPFJ_05387
Enzymes [BR:plj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     VFPFJ_05387
Protein kinases [BR:plj01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   VFPFJ_05387
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo YrbL-PhoP_reg
Motif
Other DBs
NCBI-GeneID: 28887516
NCBI-ProteinID: XP_018179947
UniProt: A0A179HNI0
Position
Unknown
AA seq 416 aa AA seqDB search
MFDVTRLTWLLLRWIVAGMLNRLHGQPESYDKKSKYRFGRTLGAGTYGVVREADGPTGKV
AVKIILKKNVKGNERMVYDELDMLQRLKHPHIVKFVDWFESRDKFYIVTQLATGGELFDR
ICDQGKFTEKDASQTIKQVLSAVDYLHDNDVVHRDLKPENLLYLTRELESDLVLADFGIA
KTLDSKEDTLKTMAGSFGYAAPEVMEQKGHGKPVDMWSLGVITYTLLCGYSPFRSENLRD
LLHECTSSQVVFHERYWKEVSDDGKDFILKLIVPEPEQRWTSKQALGHIWLTGKNATEHD
LVPELLKARELRSKFKHAVLAASLKKRIADLKDADSDSDNEMRDAEQAIPSASSASLPKP
DAKTASLKDKISGAMFREVVLAKLKDEKQKKEALEVDQELENEVRRRSFNGSSGAA
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgttcgacgtgacacgactaacctggttgcttctgcgctggatagtcgccggaatgctc
aaccgccttcacgggcaacccgagagctatgacaaaaaatccaagtacaggttcggccgg
actctgggtgcaggcacatacggcgtcgtgcgggaggccgatggccccacgggcaaggtg
gctgtcaagatcattctgaagaagaatgtcaagggcaacgagcgcatggtatacgacgag
cttgacatgcttcaaaggctgaagcatcctcacatcgtcaagttcgtcgattggttcgaa
tcgagggacaagttctacatcgtcacgcagctggccaccggaggcgaactctttgaccga
atttgcgaccagggaaagttcaccgagaaggatgcttcgcaaacaatcaagcaggtgctc
agcgctgtcgactatcttcacgataacgacgttgttcatcgagacttgaaacccgagaac
ctcctttacttaaccagggagctcgaatctgatctggtcttggcagacttcggcattgca
aagaccctggacagcaaggaggacaccctcaagaccatggcgggctcctttggctatgcc
gccccggaggtcatggagcaaaaaggccacggcaaacctgtcgacatgtggtcgcttggc
gtcatcacctacactcttctttgtggctattcgccgttccgcagcgaaaacttgcgcgac
ttgcttcacgaatgcacctcgtcgcaagttgtcttccacgagcgctactggaaggaggtg
agcgacgacggcaaggacttcatcctcaaactgattgtgccggagcccgagcagagatgg
acgagcaagcaagcattgggccacatctggttgaccggcaagaatgctaccgagcacgac
ttggtgcccgagctgctcaaagctcgcgagctcaggagcaagttcaagcatgccgttctg
gctgcaagtctgaagaagaggatcgcggacctcaaggatgccgactcagactcagacaac
gagatgagggatgccgagcaagccattcccagcgcctcctctgcatctctgccgaaacct
gacgccaaaacggcctcgctcaaggacaagattagcggtgccatgttccgcgaagttgtg
ctcgcgaagctcaaggatgagaagcagaagaaggaggcgctggaggttgaccaggagctc
gagaatgaggtcaggcggcgcagcttcaatggctcatcgggagctgcttga

DBGET integrated database retrieval system