KEGG   Purpureocillium lilacinum: VFPFJ_05943
Entry
VFPFJ_05943       CDS       T05029                                 

Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
plj  Purpureocillium lilacinum
Pathway
plj00100  Steroid biosynthesis
plj01100  Metabolic pathways
plj01110  Biosynthesis of secondary metabolites
Module
plj_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:plj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    VFPFJ_05943
Enzymes [BR:plj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     VFPFJ_05943
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 28888069
NCBI-ProteinID: XP_018178250
UniProt: A0A179HIX0
Position
Unknown
AA seq 485 aa
MAKSKAAAAAPAQHGYEFFGPPGAFGISFGLPILVYVFTFACNDISGCPAPSLLSPKTLS
LDRLKVEVGWPKEGIAGLASWEATAAVLGYYLVNLILYRVLPATEVDGTVLASGGRLKYR
FNTLYSNTVTLAALAAGTFAQGAEFPVWTFIDQHYVQILTANIGISYAISTFAYVRSFSV
KAGDKQNRELAAGGHSGNLLYDWFIGRELNPRVTIPLIGEVDIKEWCELRPGMMGWIILN
CAWCARQYRNFGFVTDSIVCITVVQALYIVDSWWNEPAILTTMDITTDGFGMMLAFGDLV
WVPFVYSMQTRYLSVHPRSLGPLGLVAMLSLIGAGFYIFRSANSQKNAFRTNPNDPAVAN
LKYIQTKTGSKLLTTGWWGVARHINYLGDWIQSWPYSLPTGLAGYQILTAGTGAEGAYVM
RDGREVAQGSAKGWGMLFTYFYIVYFAILLIHRDRRDDEKCHRKYGEDWEKYKKEVRWRI
VPGIY
NT seq 1458 nt   +upstreamnt  +downstreamnt
atggccaagtcaaaggctgcggcggctgcccctgcgcagcatggctacgaattcttcggc
cccccgggcgccttcggcatctcgtttggcctgcctattctcgtctacgtcttcaccttt
gcctgcaacgacatctcaggctgcccagcgccgtcgctcctgagtccgaagacgctgtcg
ctcgaccgcctcaaagtcgaggttgggtggccgaaggagggcattgctggtctcgctagc
tgggaagcaaccgctgccgttctgggatactacctggtcaatcttatcctctatcgcgtg
ctgcccgcgaccgaggtggacggcaccgtcctcgcgtcaggtgggcgcctcaagtatcgc
ttcaacactctgtactcgaacacggtcactctagctgcgctcgctgccgggactttcgct
cagggggctgaattccccgtgtggacctttatcgaccagcactatgttcagatattgaca
gccaatattggcatttcctatgccatctccacgtttgcctacgtgcgcagcttcagcgtc
aaggctggtgacaagcagaaccgggagcttgccgccggtggccactcgggcaacctcttg
tacgactggttcatcggccgcgagctcaaccctcgcgtcaccatccccctgatcggcgag
gtagacatcaaggagtggtgcgagctgcgccccggcatgatgggctggatcatcctcaac
tgcgcgtggtgcgcccgtcagtaccgcaacttcggcttcgtcacggacagcatcgtgtgc
atcactgtggtgcaggcgctgtacatcgtcgactcctggtggaacgagcccgctatcctg
acgaccatggacatcaccaccgacggcttcggcatgatgttggcctttggtgacctggtc
tgggtgccgtttgtgtactcgatgcaaacgcggtacctttctgtccacccacggtcgctt
gggccgctgggcttggtcgctatgttgtcgctcatcggcgccggcttctacatcttccgt
tccgccaacagccaaaagaatgccttccggacgaaccccaacgacccggcggtggcgaac
ctcaagtacatccagaccaagacgggaagcaagctgctgaccacgggctggtggggtgtt
gcgcgtcacatcaactacctgggcgactggatccagtcgtggccgtacagcttgccaacg
ggtctcgcgggataccagatcctcacggctggtacgggggccgagggtgcgtacgtgatg
cgggacggccgcgaggtggcgcagggctcggccaagggctggggcatgctgttcacgtac
ttttacattgtctactttgccatcctgctcatccaccgcgaccggcgcgacgacgaaaag
tgccaccgaaagtacggcgaggactgggaaaagtacaagaaggaggtccggtggcgcatc
gtgccaggcatctattag

DBGET integrated database retrieval system