KEGG   Purpureocillium lilacinum: VFPFJ_08400Help
Entry
VFPFJ_08400       CDS       T05029                                 

Definition
(RefSeq) alpha subunit of GDP-forming succinate-CoA ligase
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
plj  Purpureocillium lilacinum
Pathway
plj00020  Citrate cycle (TCA cycle)
plj00640  Propanoate metabolism
plj01100  Metabolic pathways
plj01110  Biosynthesis of secondary metabolites
plj01130  Biosynthesis of antibiotics
plj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:plj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VFPFJ_08400
   00640 Propanoate metabolism
    VFPFJ_08400
Enzymes [BR:plj01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     VFPFJ_08400
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     VFPFJ_08400
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 28890522
NCBI-ProteinID: XP_018175225
UniProt: A0A179GXA7
Position
Unknown
AA seq 331 aa AA seqDB search
MLSRTAARPLRQACLCRAFSTSSPRHGGYESTIDNLRIDGNSRVIYQGFTGQAATSNAKD
TIGYGTKVVGGVSPGKGGQTHLDLPVFGTVREAMETVKPHVSAVFVPAQFAAKAIVEAIE
AEVPLVVSVAEHIPVHDLLRVQEVLRTQSRSRLVGPNCPGVISPDRCRVGIMPYRQYRRG
RVGIVSKSGTLSYESVGATSAAGLGQSLVIAVGGDSMPGTTIADSLEVLLTDPETDGIII
IGEIGGEQELHAAEMLARHRRSTPNPKPVIAMVAGQTAPMGKIMGHAGAVLSPRDATAAE
KAAALERAGAVIVPHPGVMGVTMKELLGVKE
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgctgtctcgcaccgcagcacgcccgctgcggcaggcatgcctttgcagagcgttctcg
acatccagtccgcggcacggcgggtacgagagcacgatagacaacttgcgcattgacggc
aattcgcgcgtcatctatcaaggcttcaccggccaagctgccacgtcaaatgccaaggac
acaatcggatacggcaccaaggtcgtgggcggcgtctcccccggcaaaggcggccagacg
cacctcgacctccccgtctttggcaccgtccgcgaggccatggaaacggtcaagccgcac
gtcagcgccgtcttcgtgccggcgcagttcgcggccaaggccatcgtcgaggccatcgag
gccgaggtaccgctcgtcgtgtccgtggccgagcacatccccgtgcacgacctgctgcgc
gtgcaggaggtgctgcggacgcagagccgcagccgcctcgtcgggcccaactgcccgggc
gtcatctcgccggaccgctgccgcgtcggcatcatgccctaccgccagtaccgccgcggg
cgcgtcggcatcgtcagcaagtcgggcaccctgagctacgagtcggtgggcgcgacgagc
gcggcggggctggggcagagcctggtgatagccgtgggcggcgactcgatgccgggcacg
accattgcagactcgctcgaggtgctcctcaccgaccccgagaccgacggcatcatcatc
atcggcgagattggcggcgagcaggagctgcacgctgccgagatgctcgcgcggcaccgc
cggtcgacgccgaaccccaagcccgtcatcgccatggtggcgggccaaacggcgccgatg
ggcaagatcatgggccacgcgggggcggtgctgtcgccgagggacgcgacggcggcggag
aaggcggccgcgctggagagggcgggcgccgtgattgtgccgcacccgggcgtcatgggt
gtgacgatgaaggagctgctgggcgtcaaggagtga

DBGET integrated database retrieval system