KEGG   Purpureocillium lilacinum: VFPFJ_08784Help
Entry
VFPFJ_08784       CDS       T05029                                 

Definition
(RefSeq) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
plj  Purpureocillium lilacinum
Pathway
plj00260  Glycine, serine and threonine metabolism
plj01100  Metabolic pathways
plj01110  Biosynthesis of secondary metabolites
plj01130  Biosynthesis of antibiotics
plj01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:plj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VFPFJ_08784
Enzymes [BR:plj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     VFPFJ_08784
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-GeneID: 28890906
NCBI-ProteinID: XP_018175609
UniProt: A0A179GCK5
Position
Unknown
AA seq 354 aa AA seqDB search
MPDATIFPPKDKYSFLDDYSEGAHPQVLEALIASNATQETGYGNDRYSGAARQHIRDHLG
RGDVGIFFVPSGTSANAISIAACLRPHEAVIAASSGHIVTRETGAVEASGHKIINVAPTN
GKLTPASIEKALDDNWHYPHMAKPRLVYISNATEVGTVYSKAELGAIKALCEERGLLLFM
DGARIGAALTSRVNDMTLGDIVDLTDIFWIGGTKNGALLGEAVVVKHAQLAQDFEFYVKQ
HGSLLAKGRMMGVQFAELFRGDLYFELARRGNAAAEKLSRSVVGAGYALRADTETNQVFA
VLPLGLVKELQRDFSFYVWEKCGADWAVVRLLTTWATDTAQLEKFNQTVLSWAP
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgcccgacgcgaccatctttccgcccaaggacaagtacagcttcctcgacgactactcg
gagggagcgcacccccaggtgctcgaggcactgatcgcgagcaacgcgacgcaggagacg
ggatatggcaacgaccgatacagcggcgcggcgcgacagcacatccgtgaccacctgggg
cgcggggacgtgggcatcttcttcgtgccaagcggaacgtcggccaacgccatctcgatc
gcggcgtgcctgcgaccgcacgaagccgtcatcgcggccagctcgggccacatcgtgacg
cgcgagacgggagcggtcgaggcgagcgggcacaagatcatcaacgtggcgccgaccaac
ggcaagctgacgccagcgagcatcgagaaggcgcttgacgacaactggcactacccgcac
atggcgaagccgcggctcgtgtacatctccaacgcgaccgaggtgggcacggtgtactcc
aaggcggagctgggggccatcaaggcgctgtgcgaggagcgcgggctgctgctcttcatg
gacggggcgcgcatcggcgcggcgctgacgtcgcgggtcaacgacatgacgctgggcgac
atcgtggacctgacggacatcttctggatcggcgggaccaagaacggcgcgctgctgggc
gaggccgtcgtcgtcaagcacgcgcagctggcgcaggactttgagttttacgtcaagcag
cacggctcgctgctggccaagggccgcatgatgggcgtgcagttcgccgagctgttccgc
ggcgacctgtactttgagctggcgcgccggggcaacgccgcggccgagaagctgtcgcgg
tccgtcgtgggcgcgggctacgcgctgcgcgccgacacggagacgaaccaggtgttcgcg
gtgctgccgctcgggctggtcaaggagctgcagcgcgacttttcgttttacgtgtgggaa
aagtgcggcgccgactgggccgtcgtgcggctgctgacgacgtgggcgacggacacggca
cagctggagaagtttaaccagacggtgctgagctgggcgccgtga

DBGET integrated database retrieval system