KEGG   Purpureocillium lilacinum: VFPFJ_08864Help
Entry
VFPFJ_08864       CDS       T05029                                 

Definition
(RefSeq) invertase precursor
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
plj  Purpureocillium lilacinum
Pathway
plj00052  Galactose metabolism
plj00500  Starch and sucrose metabolism
plj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:plj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    VFPFJ_08864
   00500 Starch and sucrose metabolism
    VFPFJ_08864
Enzymes [BR:plj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     VFPFJ_08864
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 28890986
NCBI-ProteinID: XP_018175689
UniProt: A0A179H0Q0
Position
Unknown
AA seq 598 aa AA seqDB search
MRSCPATLCCALQLLAGTCLAQTSANSSSTSPPPAVKTTTTTPAGAYVGPNVTAGRPIVG
DYRGQYRPQVHFSPPRHFMNDPNGMFRDDAGTWHLYYQYNPTDIVAGNQHWGHATSSDLY
HWVNQPIALYPPRKDVYVFSGSAVVDRNNTSGFFPNQTNGVVAIYTLAEYDSDGSPGPQT
QAIAYSHDNGYSFIPYHGNPVIPSDSPQFRDPKVVWHEGHWVMAVAYPHDFAVGIFTSPN
LIDWNPTSNFSHHGLLGLQWECPNLVRMPYVDEKGERRDDMWLMVVSINPGAPLGGSVAQ
YYPGTFNGTHFEAVDAAARIADFGKDSYAGQFFYGSPDDAEDPVFMSWASNWQYTQTVPT
ADEGWRSAMSLPRRTHLTKSPRVGWKLVTVPYDLSPVMGDALASNDSIANGTITVDFSDV
PSNALYWELNVTGLPDSGDISPTATMNFTFSSPVTGEYLRGGMFFGGDSPFFLDRGGTRG
FDDVFFTDKVSTNSIVSGASWNMSGILDRSVLELFVNGGIDSATTTFFPTQPLTLAVFGT
AGLPEGARVSVRVNALRSAWEGMASEADGLVHGNQSSRDTGVEDVRRMLLLREGDAGI
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgagatcatgccctgcgaccctctgctgtgccctgcagctccttgcgggcacatgcctc
gcgcagacgtcggccaactcgtcttcgacgtcaccgcctccggccgtgaaaacaacaacc
acaacaccggccggcgcctacgtcggccccaacgtcacggccgggcggcccatcgtcggc
gactaccgcggccagtaccggccccaggtccacttctcgccgccgaggcacttcatgaac
gaccccaacggcatgtttcgcgacgacgccggcacctggcacctctactaccagtacaac
ccgaccgacatcgtggccggcaaccagcactggggccacgccacctcgtccgatctctac
cactgggtgaaccagcccatagccctgtacccgccccggaaggacgtctacgtcttttct
gggagcgccgttgtggataggaacaatacttcgggcttctttcccaaccagaccaacggc
gtcgtagccatctacacgctggccgagtacgactcggacggcagcccgggtccccagacc
caggccatcgcctactcccacgacaacggctacagcttcataccttaccatggcaacccc
gtgatccccagcgactcgccgcagttccgcgaccccaaggtcgtctggcacgagggccac
tgggtcatggccgtggcgtacccacacgacttcgccgtcggcatcttcacctccccaaac
ctcatcgactggaacccaacaagcaacttttcacatcacggcctcttgggtctgcaatgg
gagtgtcccaacctcgtcaggatgccctacgtcgatgaaaagggcgagaggagggatgac
atgtggctcatggtggtctcaatcaaccccggagcgccgttgggagggtcggtcgcgcag
tattacccgggcacgttcaacggcacgcacttcgaggccgtcgacgcggcggcccgcatc
gccgactttggaaaggacagctacgcagggcagttcttctacggcagccccgacgacgcc
gaggaccccgtcttcatgtcgtgggcgtccaactggcagtacacgcagacggtgccgacg
gccgacgagggctggcgcagcgccatgagcctcccgcgccggacgcatctcaccaagtcg
ccgcgcgtcgggtggaagctcgtgactgtgccgtacgacctgagccccgtcatgggcgac
gccctggcgtccaacgacagcatcgccaacggcacaatcaccgtcgacttctccgacgtg
ccgtccaatgcgctgtactgggagctcaacgtgacgggtctgcccgactctggcgacatc
tcgccgacggccaccatgaactttaccttttccagccccgtcaccggcgagtacctccgg
ggcggcatgttcttcggcggcgactcgcccttcttcctcgaccgcggcggcacgcgcggc
ttcgacgacgtcttcttcacggacaaggtgtcgaccaacagcatcgtctcgggcgcgtcg
tggaacatgagcggcatcttggaccgctcggtgctggagctctttgtcaacggcggcatc
gacagcgcgaccacgactttcttcccaacgcagccgctgacgctcgccgtcttcggcacc
gcgggcctgcccgagggggcgcgcgtcagtgttcgggtgaatgcgcttcgcagtgcctgg
gagggcatggcgagcgaggccgacggcctggtgcacggcaaccagtccagcagggacact
ggggttgaggacgtgaggcgcatgctgctgctgcgagagggagatgcgggcatttga

DBGET integrated database retrieval system