KEGG   Purpureocillium lilacinum: VFPFJ_09945Help
Entry
VFPFJ_09945       CDS       T05029                                 

Definition
(RefSeq) two-component system protein A
  KO
K19692  osomolarity two-component system, sensor histidine kinase TcsA [EC:2.7.13.3]
Organism
plj  Purpureocillium lilacinum
Brite
KEGG Orthology (KO) [BR:plj00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:plj01001]
    VFPFJ_09945
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:plj02022]
    VFPFJ_09945
Enzymes [BR:plj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     VFPFJ_09945
Protein kinases [BR:plj01001]
 Histidine kinases
  Other
   VFPFJ_09945
Two-component system [BR:plj02022]
 Other families
  SLN1-YPD1-SSK1/SKN7 (osmosensing)
   VFPFJ_09945
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Response_reg HATPase_c HisKA PAS_4 PAS_9 PAS
Motif
Other DBs
NCBI-GeneID: 28892063
NCBI-ProteinID: XP_018174476
UniProt: A0A179GQP1
Position
Unknown
AA seq 689 aa AA seqDB search
MSEILDYSPVPTLVVSPSYRVERASAGLLEAWRCSREQIVGEDLFTALYHGSPTARFDRI
PLAFAIETGIASRALRLCHAAYTDPEGVAWTARITPIHKDDGLICLIFEWEKAEVHITVA
DGGIRQSWLPIDEASRILVEAVKDYAIFLLDTRGNIMTWNIGAELNKGYKKEEIIGKHFS
IFYGEEDLKSHKPERELEVCLREGRVEDEGWRYRKDGSRFWANVVITAVYRNGIHVGFGK
VTRNLTERKEAEMRLIAAYEESTKLKNDFLANISHEIRTPMHGMLSACSLLLDSDLTEEQ
LETANIIEESGRVLLQVINDILDYSKLAAGSFSITNEKFDVAHVVTSVVRSFQTTVQPGV
SLKTDLATDLPKWAEGDALRCRQILENIVGNAGKFTERGYIIVRVSLAAQDAATHTIMTE
VIDTGHGVRDESELKLFQPFTQLDTTYQKRRQGTGLGLSIAKSLVEMMGGDIGYKPNPDQ
PGSIFWFTVKLKRVDGPQQISAQPERELLRQQIPQDNDIAAPLSRLLRIASQTRLLAAED
NIINQKVLVGILHAFGFQHITVVSNGAEAVSTLANSPDAFDLCLMDISMPVMNGYEATVQ
IRNSGSRIPIIAMTAYALKGDMERCLEKGVNDYLAKPVNRQLLMQKLLKWLPKPGDGDVA
VPNGCHGDAQKPLNGVLRHTRSASDRQSI
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagattctcgactactcgcccgtgcccacgctggtcgtgtcgccgtcgtaccgc
gtcgagagggcctcggccggcttgcttgaggcgtggcgctgctctcgggagcagattgtc
ggcgaggacctctttaccgctctctaccacgggtcgccgacggcgcgattcgaccgcatt
ccactcgcattcgccatcgaaacgggcatcgcgtctcgcgcccttcggctctgccatgcg
gcgtacaccgacccggagggcgtcgcctggaccgcgcgcatcaccccgatccacaaggac
gacggcctgatctgcctcatctttgagtgggaaaaggccgaagtccatattaccgtcgcc
gacggcggcatccgccagagctggctgcccatcgatgaggcgtcgcgcatcctcgtcgag
gccgtcaaggactatgccatcttcctgctcgacacgcgcggcaacatcatgacctggaat
attggcgccgagctcaacaaagggtacaaaaaggaagagattatcggcaagcacttctcc
atcttctatggcgaggaggacctcaagtcccacaaacccgagcgggaactcgaggtatgc
ctgcgcgaggggcgcgtcgaggacgaaggctggcgctatcgcaaagacggcagccggttc
tgggccaacgtcgttatcacggctgtgtatcgaaacggcatccacgtcggcttcggcaaa
gtcacccgcaacctcacggagcgcaaagaggccgagatgcggctcattgccgcctacgag
gagagcaccaagctgaaaaacgacttcctggccaacatcagtcacgagatccggacaccg
atgcacggcatgctctctgcctgctcgcttctgctggacagtgacctgaccgaggagcaa
ctcgagacggccaacatcattgaggagtcggggcgcgttctcctgcaggtcatcaacgac
attctcgactactccaagctcgcggctggcagcttctcgatcacaaacgaaaagttcgac
gtagcgcatgttgtgacgtccgtcgtacgcagcttccaaacgacggtacaaccaggcgta
tcgctcaagacggacctggctacggacctgccaaagtgggcggagggggacgccttgcgc
tgtcgccagattctcgaaaacattgtcggcaacgcgggcaagttcaccgaaaggggttac
atcattgtgcgcgtatctctggcggcgcaggatgcagcgacacacaccatcatgaccgaa
gtcatcgacaccggacacggcgtccgcgacgagtccgaactgaagctcttccaaccgttt
acgcagctcgacactacatatcagaagcgccggcaggggacgggccttggtttgtccatc
gccaagtccctcgttgaaatgatgggcggggacattgggtataagcccaaccccgaccag
cccggcagcatcttttggttcaccgtgaagttgaagcgagtcgatgggccgcaacagatt
agcgcgcagcccgaaagagaactattgcgacagcaaatcccacaagataatgatatcgca
gcgccattatcgcggttgctacggatcgcctcgcaaacacgactcctggccgccgaggac
aacatcatcaaccaaaaggtattggtcgggattttgcacgccttcggcttccagcacatc
actgtcgtctcgaatggcgccgaagccgtctcgacgcttgcaaactctcccgatgccttt
gacctgtgtctcatggacatcagcatgcccgtgatgaacggctacgaggcgacggtgcag
atacgaaatagcggctcgcgcatacccatcatcgccatgactgcatacgcactcaagggc
gacatggagcgttgtctagagaagggcgtcaacgattacctggccaagccggtcaatcga
cagttgctcatgcagaagctgctcaagtggcttcctaagccaggcgacggcgatgtagcc
gtaccgaacggctgtcatggagacgcacagaagcccctgaatggcgtgctccggcatacg
cggtctgcctcggaccggcagagtatttga

DBGET integrated database retrieval system