KEGG   Purpureocillium lilacinum: VFPFJ_10272Help
Entry
VFPFJ_10272       CDS       T05029                                 

Definition
(RefSeq) glycoside hydrolase family 32 protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
plj  Purpureocillium lilacinum
Pathway
plj00052  Galactose metabolism
plj00500  Starch and sucrose metabolism
plj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:plj00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    VFPFJ_10272
   00500 Starch and sucrose metabolism
    VFPFJ_10272
Enzymes [BR:plj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     VFPFJ_10272
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 28892389
NCBI-ProteinID: XP_018174036
UniProt: A0A179GJ67
Position
Unknown
AA seq 543 aa AA seqDB search
MSWGHATSMDMLTWVSASVTPALIPGATYDCEGVFTGCWLPPSKASDKTLRVAYSSVKHL
PFHWSTPPYPRNAAGLAIASSLDGGLTWEKSPRNPILPGEPAGVAVTGFRDPSVFELQPT
VRTPRTPTPNLYGLIAGGVEGSGPNVFVYEIDIENPEDWNYRGTLLSLPPRFQPSNHWSG
NYGVNWECVNLVTLRSDSETRHFLLLGAEGDVEKQQVKSQPRSTAAPSRTIRPQLWLSGE
LTPTSSGLQLRPQYGGYFDHGPYYAANSFHDPVSDRRIVYGWIPEEDISLEAAKAKGWNG
SLAIPREMFLLTIRNVEGSMRSDLSDIFPFEIKRESDGSITILTLGVRPIQEMARLREGC
DDVSESKNVITLPMSDLITHQVISQAQSANWELEAIISVQPGCKTVGFHVRHTNDLSVRT
SITFCIDTETISVDRSASTTDPAVNTCMDAGPFTLLTQRPPGEEASLEKLKIRIFSDGNI
LEIFANDCFALATMVYSERCGPRTGGISAFATGGLGSAVFEAVHVYDGLDVNKLPRTVDE
VPG
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgtcctggggccacgccacatctatggacatgctgacttgggtatctgcctctgtgacc
ccagcgctcattccaggcgctacctacgattgtgaaggcgtctttactggctgctggctt
ccgccctctaaagcttcagacaaaacattgcgagtggcctactcttctgtcaagcatctt
ccgtttcactggagcacaccaccttacccgcgaaatgcagctggtctggcgatagcatcg
tcgcttgatggaggacttacctgggagaaatcgcctcgaaatccaatcttgcctggcgag
ccagccggtgtagcagtcacaggctttcgcgacccttccgtctttgagctccagccgacg
gtccggactcctcgcacgccgacaccaaacctttacggtctcattgctggcggcgttgag
gggtcggggcctaacgtcttcgtctatgagattgacattgagaacccggaagattggaac
tatcgtggcacgttactgagcttgcccccgagatttcagccttcgaatcattggagtggc
aactatggagtcaattgggaatgcgtcaacctcgtcacgcttcgttcagactcagaaact
cgtcacttcctcctccttggagcagaaggggatgtggaaaagcagcaggtgaagagccag
cctcgatccacagcagcacccagtcgaactatacggccacagttgtggttatctggagag
ctcactcccacttctagtgggctgcaacttcggccacaatacggcggatactttgaccac
gggccttactacgctgcaaactcctttcacgaccccgtgagtgatcgacgtatagtgtac
ggttggatcccagaggaagacatatccttggaagccgccaaggcaaaagggtggaacggt
tcgcttgccattccgcgcgagatgttccttctcacaatacggaacgtggaagggtctatg
cgaagcgacttatccgacatctttccatttgagattaaacgggagtccgatggttcgatc
acgattcttacgcttggggtgcgacccatacaggaaatggcgagacttcgagagggttgc
gacgacgtctcagagtcgaaaaatgtcatcacattgcccatgtcggacctcatcacccat
caagtcatttctcaagctcaatcagcaaattgggagctcgaggcgatcatttcggtacag
ccagggtgcaagactgtcggcttccatgtccgccatacaaacgatctctccgtccgtacg
tccattacgttttgcattgacacggagacgatttccgtggatcgctcggcctcaacaaca
gacccagcggtcaatacgtgcatggatgctggaccgttcactctcctgacccagcgacct
ccaggcgaggaagcgtcgcttgagaaactcaaaatccgcatcttctccgacgggaacatt
ctggagatttttgcaaatgattgctttgcgttggctaccatggtctattccgagaggtgt
ggtccaaggacgggaggcataagtgcgttcgcgacgggaggactaggcagtgccgtgttt
gaagccgttcatgtgtatgacggcctagacgtgaacaaactacccagaacagtagacgaa
gttcctggctag

DBGET integrated database retrieval system