KEGG   Plantactinospora sp. KBS50: CIK06_01840Help
Entry
CIK06_01840       CDS       T05048                                 

Definition
(GenBank) aromatic acid decarboxylase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
plk  Plantactinospora sp. KBS50
Pathway
plk00130  Ubiquinone and other terpenoid-quinone biosynthesis
plk00627  Aminobenzoate degradation
plk01100  Metabolic pathways
plk01110  Biosynthesis of secondary metabolites
plk01120  Microbial metabolism in diverse environments
plk01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:plk00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    CIK06_01840
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    CIK06_01840
Enzymes [BR:plk01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     CIK06_01840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: ASW53189
UniProt: A0A248YHV7
Position
405765..406412
Genome map
AA seq 215 aa AA seqDB search
MRRPWVVGVSGASGTPYAAAVLRGLLDAGSPVDLVISRAARLTLLDETGRPFRDAHWKDD
LAGWLGRDLAGADLAYWPAGDLAAAPSSGSYPVCGMVVVPASTAACAGIAIGLSKDLLQR
AAEVNLKERRPLVVVPRETPVTRSHLEHLIALHDAGAVVLPASPGFYGAGADASAGQLVD
FVAGKVLDALGVPHTLFRRWTGDLGAARDRADRPE
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaggccgtgggtggttggggtctccggcgcatccggtacgccgtacgcggcggcc
gtgctgcgcgggttgctggacgccggcagcccggtggatctggtgatctcccgggccgcc
cggttgaccctgctggacgagaccggccgaccgttccgggacgcgcactggaaggacgac
ctggccggctggctcggccgagacctggccggcgccgacctggcgtactggccggccggt
gacctggccgcggcgccgagcagcggctcgtacccggtgtgcggcatggtggtcgtgccg
gccagcacggcggcctgcgccggcatcgccatcgggctgtcgaaggacctgctgcaacgc
gccgcggaggtcaacctcaaggagcggcggccgctggtcgtggtgccccgggagacgccg
gtgacgcgcagccacctggagcacctgatcgcgctgcacgacgccggtgccgtggtgttg
ccggccagccccggtttctacggtgccggtgcggatgcctcggccggacagctcgtggac
ttcgtcgcgggcaaggtgctcgacgccctcggcgtcccgcacacgctgttccggcgctgg
accggcgatctgggcgcggcccgggaccgggccgaccgcccggagtga

DBGET integrated database retrieval system