KEGG   Plantactinospora sp. KBS50: CIK06_04100Help
Entry
CIK06_04100       CDS       T05048                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
plk  Plantactinospora sp. KBS50
Pathway
plk03010  Ribosome
Brite
KEGG Orthology (KO) [BR:plk00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CIK06_04100
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:plk03011]
    CIK06_04100
Ribosome [BR:plk03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    CIK06_04100
  Bacteria
    CIK06_04100
  Archaea
    CIK06_04100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ASW53538
UniProt: A0A248YIR5
Position
893514..894011
Genome map
AA seq 165 aa AA seqDB search
MPVKGDAPVLPGARAVARHVRISPTKARRVVNLVRGLPAKEALTVLQFAPQAASEQVYKV
LASAIANAENNERLDPDALLVSEAFVDEGPTMKRFRPRAQGRAYRIRKRTCHITIAVEAV
VAAAPARKAGKKAAPAKQSAATQDEPAAAAQGEAAQTQSNTEGAE
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgccagttaagggcgacgctccggtgcttccgggcgcgcgggcggttgcgcggcacgtg
cgcatctcgccgaccaaggcgcgccgggtggtcaacctcgtccgcggtctgcccgcgaag
gaggcgctcacggtgctccagttcgcgccgcaggccgccagtgagcaggtgtacaaggtg
ctcgccagcgcgatcgccaacgcggagaacaacgagcggctggaccccgacgcgctgctc
gtcagcgaggcgttcgtggacgagggcccgaccatgaagcggttccggccgcgtgcgcag
ggccgggcgtaccggatccgcaagcgcacctgtcacatcacgatcgcggtcgaggcggtc
gtggccgctgcgccggcgcgcaaggccggcaagaaggccgcgcccgccaagcagagcgcg
gcgacgcaggacgagccggccgccgcggcgcagggcgaggccgcgcagacgcagagcaac
acggaaggtgccgagtaa

DBGET integrated database retrieval system