KEGG   Plantactinospora sp. KBS50: CIK06_10095Help
Entry
CIK06_10095       CDS       T05048                                 

Definition
(GenBank) GTP cyclohydrolase
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
plk  Plantactinospora sp. KBS50
Pathway
plk00740  Riboflavin metabolism
plk00790  Folate biosynthesis
plk01100  Metabolic pathways
plk01110  Biosynthesis of secondary metabolites
plk02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:plk00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    CIK06_10095
   00790 Folate biosynthesis
    CIK06_10095
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CIK06_10095
Enzymes [BR:plk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     CIK06_10095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: ASW54461
UniProt: A0A248YLF4
Position
2279254..2279901
Genome map
AA seq 215 aa AA seqDB search
MSDALPNATVRTRVTVPLQFPDGYAVDARVFTFDGLVDGREHLALGLGDWAAAVERQADE
APLVRPHSECLTGDVFGSQRCDCGPQLREGVQRIAGAGGFLLYLRQEGRGIGLYPKLDAY
ALQDTGLDTYQANLALGHRADERDYTVAAQMLSALGVRRVSLLTNNPDKAGQLRRLGLAV
VDQVSTGIYLSPANAGYLAAKASHHARASDVPSVR
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacgcactgccgaacgccacggtccggacgcgggtcacggtgcccctccagttc
cccgacgggtacgccgtggacgcgcgggtgttcaccttcgacggactggtggacgggcgg
gaacacctggctctcggcctgggcgactgggcggccgcggtggagcggcaggcggacgag
gcgccactggtccgcccgcacagcgagtgcctcaccggtgacgtgttcggcagccagcgc
tgcgactgcggcccgcaactgcgcgagggggtgcaacgcatcgccggtgccggcggcttc
ctgctctacctgcggcaggaggggcgcggcatcggcctctacccgaagctcgacgcgtac
gcgttgcaggacaccgggctggacacctaccaggcgaacctggcgctgggccaccgcgcg
gacgagcgggactacacggtggccgcgcagatgctgtccgcgctgggcgtgcgccgggtc
agcctgctgaccaacaacccggacaaggccggccaactgcgccggctgggactggccgtc
gtcgaccaggtgtccaccggcatctacctctccccggccaacgccggatacctggcggcc
aaggcgagtcaccacgcccgcgcctccgacgtaccgtccgtgcgctga

DBGET integrated database retrieval system