KEGG   Plantactinospora sp. KBS50: CIK06_22250Help
Entry
CIK06_22250       CDS       T05048                                 

Definition
(GenBank) hydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
plk  Plantactinospora sp. KBS50
Brite
KEGG Orthology (KO) [BR:plk00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CIK06_22250
Enzymes [BR:plk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     CIK06_22250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: ASW56294
UniProt: A0A248YRF0
Position
complement(5183523..5184320)
Genome map
AA seq 265 aa AA seqDB search
MRVAVCQVNSRADRKANLEAAAELLDRAAAAGADLAVLPEYVDHLGPAATLPDPEPADGE
FAAFFAAAARRHGMWVHAGSFHEASPYPARTYNTSLLFDRTGALAGTYRKIHLYDVEIPD
RVSYLESRTVARGTDPAVFPVDGIPVGLSICYDLRFPELYRRLVNLGARILVVPAAFMLH
TGRDHWEVLLRARAIENQCYVLAAAQIGDHDPGRTCFGRSMVVDPWGTVIAQAPDTVGVT
VADLDLDRLDRIRTELPSLANRRIR
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtcgcggtgtgtcaggtgaattctcgggcggaccggaaggccaaccttgaggcg
gccgccgagttgctggaccgggcggcggcggccggcgccgacctggcggtccttcccgag
tacgtcgaccacctcgggccggcggccaccctgcccgaccctgagcctgcggacggcgag
ttcgccgcgttcttcgcggcggccgcgcgccggcacggcatgtgggtgcacgcgggctcc
ttccacgaggccagcccgtatcccgcccgcacctacaacacctccctgctgttcgaccgg
accggtgcgctggccggcacgtaccgcaagatccatctgtacgacgtggagatccccgac
cgcgtctcctacctggagtcccggacggtcgcccgcggcacggacccggcggtgtttccg
gtcgacggaatcccggtcggcctgtccatctgctacgacctgcgcttccccgagctgtac
cggcggctggtcaatctcggtgcccgcatcctggtggtgccggcggccttcatgctgcac
accgggcgcgaccactgggaggtgctgctgcgcgcccgggccatcgagaaccagtgctac
gtgctggccgcggcgcagatcggcgatcacgatcccgggcgtacctgcttcggccgcagc
atggtggtcgacccgtggggcacggtcatcgcccaggcgccggacacggtcggtgtgacc
gtggcggacctcgacctggaccgcctggaccggatccgcacggagctgcccagcctggcc
aaccggcgcatccgctag

DBGET integrated database retrieval system