KEGG   Plantactinospora sp. KBS50: CIK06_25125Help
Entry
CIK06_25125       CDS       T05048                                 

Definition
(GenBank) 23S rRNA methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
plk  Plantactinospora sp. KBS50
Brite
KEGG Orthology (KO) [BR:plk00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:plk03009]
    CIK06_25125
Enzymes [BR:plk01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     CIK06_25125
Ribosome biogenesis [BR:plk03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    CIK06_25125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_12
Motif
Other DBs
NCBI-ProteinID: ASW56735
UniProt: A0A248YT19
Position
5826384..5827268
Genome map
AA seq 294 aa AA seqDB search
MRADVLSRLRCPVCADPLDAADRSVRCPRGHSFDLARQGYVNLLTGQTRHRGDSAEMVAA
REEFLLAGHYDPITGLVAGAAARELAGDGGAAYPEPAGAAGAAYPDLVVDAGAGTGRYLG
AVLDAAPAAVGLALDVSKPALRRAARAHPRASAALADTWRGLPVADRAARLVLNVFAPRN
GPEFHRVLRPDGTLLVLTPAADHLGALVDRLRLLRVDPDKADRTADRLADRFDLVRRDPH
RYDLDLPREAVGALVGMGPSAWHTDPEALAAGLRRLPDRVPVTVSVELASYRPR
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccgacgtgctgagccggctgcgctgcccggtctgcgcggatccgttggacgcg
gccgaccgcagcgtccgctgcccgcgcgggcacagcttcgacctggcccgccaggggtac
gtcaacctgctgaccggccagacccggcatcgcggggacagcgccgagatggtggccgcc
cgggaggaattcctgctggccggccactacgacccgatcaccgggctggtcgccggggcc
gcggcgcgggaactggccggcgacggcggtgcggcgtacccggaaccggccggcgcggcc
ggagcggcgtacccggatctggtggtggacgccggcgccgggaccgggcggtacctcggc
gcggtcctggacgcggcgcccgccgccgtcgggctggcgctggacgtgtcgaagcccgcc
ctgcggcgcgcggcgcgggcgcacccccgggcctccgccgccctcgccgacacctggcgt
ggcctgccggtcgccgaccgcgcggcacggctggtgctgaacgtgttcgctccccgcaac
ggtccggagttccaccgggtgctgcggcccgacggcacgctgctggtgctcaccccggcc
gccgatcatctcggcgcgcttgtcgaccggctccggctgctgcgggtcgacccggacaag
gccgaccggacggccgaccggctggccgaccggttcgacctggtccggcgggacccgcac
cggtacgacctggacctgccgcgggaggcggtcggcgccctggtcgggatgggaccgagc
gcctggcacaccgacccggaggcgctggccgccgggctgcggcggctgcccgaccgggtg
ccggtcaccgtctcggtggagttggccagctaccggccccgctga

DBGET integrated database retrieval system