KEGG   Plantactinospora sp. KBS50: CIK06_28085Help
Entry
CIK06_28085       CDS       T05048                                 

Definition
(GenBank) glycosyl hydrolase
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
plk  Plantactinospora sp. KBS50
Pathway
plk00460  Cyanoamino acid metabolism
plk00500  Starch and sucrose metabolism
plk01100  Metabolic pathways
plk01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:plk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CIK06_28085
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    CIK06_28085
Enzymes [BR:plk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     CIK06_28085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C Fn3-like
Motif
Other DBs
NCBI-ProteinID: ASW57176
UniProt: A0A248YTW9
Position
complement(6489951..6492266)
Genome map
AA seq 771 aa AA seqDB search
MTEVHAGVDGPVPAQAGLDHGRPAGEARVRELLARMTIEEKVAQLVGFWEAKDGEAVTPL
QGEFSDIAKLKDFSRNGLGHLTRAYGTSPVDPDARAAWLWEFQSGLVTDTRLGIPAIVHE
ECLTGLSAWKAATFPTPLAWGAAFDPELVHEMATAVGASMRALGIHQGLAPVLDVIFDPR
WGRVDECISEDPYLVGTIGTSYVRGLQSQRVQATLKHFAAYSASQAGRNFGPVHAGPREL
ADVIFIPFEMAILDGGASCIMHSYAEIDGLPVASDATMLTGVLRDRWGFDGTVVSDYFGV
AFLHLLHHVAGDRAEAAGQALTAGVDIELPTGDAYLTLRESVTAGRLDEALVDRAVLRVL
RQKLELGLLDETFMDAPPSAVDLDSPQHRSIARRLAEKSIILVSNRDALPLPSNSRVAVI
GPNADRQGALFGCYSFLNHVLAQHPEVEIGIEVPTVLDAVRVEFGDDLVTWARGCDVDSD
DRSGFDEAVATGSAADVAVLVVGDQAGLFGRGTVGEGCDRDDLELPGVQRELVEAVLATG
TPVVLVLLTGRPYVVGWALPRCAAVVQAFFPGEEGSGAIAGVLSGRVNPSGKLPISLPGA
VGAQPYSYLHPTLGEGSEVTNLPATPAAPFGHGLSYTTFEHGDLTVPATVPVDGALPVTV
RVTNTGAVAGDDVVQLYGRDLVASVTRPVAQLLGYRRVHLEPGQSVTVELTVPTTRLAFS
DRTLTRVVEPGDVEVWVGTSVQRDTQAVTTLVGETVPVTNASERWTISEIS
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
atgactgaggtccacgccggggtggacgggccggtgccggctcaggcgggtctggaccac
ggccggccggcgggcgaggcacgggtacgcgagctgctcgcccggatgacgatcgaggag
aaggtcgcccagcttgtcgggttctgggaggcgaaggacggcgaggctgtcacgccgctg
cagggcgagttcagcgacatcgccaagctcaaggacttctcccgcaacgggctcggccac
ctcacccgtgcctacggcacctcgcccgtcgacccggacgcccgcgcggcgtggctgtgg
gagttccagtccggcctggtaacggacaccaggctgggaatccccgcgatcgttcacgag
gagtgcctgaccgggctctccgcgtggaaggcggccaccttcccgacgccgctggcctgg
ggcgccgcgttcgatcccgaactggtccacgagatggccaccgccgtcggggcgtcgatg
cgggcactgggcatccaccagggcctcgccccggtgcttgatgtgatctttgatccgcgg
tggggccgggtcgacgagtgcatctccgaggacccgtacctcgtcggcacgatcggcaca
tcgtacgtgcggggcctgcaatcgcagcgggttcaggccaccctcaaacacttcgccgcc
tactccgcctcgcaggccgggcgcaacttcggacccgtgcatgcgggcccccgcgagctt
gccgatgtgatattcatcccgttcgagatggcgatcctcgacggtggcgccagctgcatc
atgcactcctatgccgagatcgacggcctgccggtcgcgtccgatgcgacgatgctcacc
ggtgtcctgcgggacaggtggggattcgacggcaccgtcgtctccgactacttcggcgtg
gcgtttctgcacctgctgcaccacgtcgccggagaccgcgcggaggcggccgggcaggcg
ctgaccgccggcgtcgacatcgagcttccgaccggcgacgcctacctgacgctgcgggag
tcggtgacggcaggcaggctcgatgaggccctcgtcgaccgggcggtgctgcgggtcctg
cgccagaaactggagctcgggctactcgacgagaccttcatggacgccccaccctcggcg
gtcgacctcgactcgccgcagcaccgttcgatcgcccgccggcttgccgagaagtcgatc
atcctggtctccaaccgggacgcccttccgttgccctcgaacagccgcgttgcggtcatc
ggcccgaacgccgaccggcagggggcgctcttcgggtgctactccttcctcaaccacgta
ctcgcccagcatcccgaggtggagatcgggattgaggtaccgacggtcctcgacgccgtg
cgggtcgagttcggcgacgatctcgtcacctgggcgcgcgggtgcgacgtggactccgac
gaccggtccggcttcgacgaggccgtcgccaccggatccgccgcggacgtagccgtgctg
gtcgtcggcgaccaggctggcctcttcgggcgtgggacggtcggcgagggctgtgaccgg
gacgacctcgaactgcccggagtccagcgcgaactcgtcgaggccgtgctggccacgggt
acaccggtcgtcctcgtcctgctcaccggccggccgtacgtggtcggctgggcgttgccg
aggtgcgcggcggtggtgcaggcgttcttccccggcgaggagggttccggggcgatcgct
ggcgtgctttccgggcgggtcaacccgtcgggcaagctgccgatcagcctgcccggtgcg
gtaggggcgcagccgtactcgtacctgcacccgacgctcggggagggcagcgaggtgacg
aacctgccggcgacgcccgcggcgccgttcggccacggtctgtcctacaccacgttcgag
catggcgacctcaccgtgcccgccacggtgccggtcgacggggcgttgcccgtcacggtg
cgggtgacgaacaccggggcggtggcgggggacgacgtggtccagctctacggccgtgat
ctggtggcctcggtgacccggccagtggcgcagctgctcggataccggcgggttcacctg
gagccgggccagtcggtcacggtcgaactgaccgttcccaccacccgtctggccttctcc
gaccgcaccctgacccgggtcgtggagccgggtgacgttgaagtctgggtcggtacgagc
gtgcagcgggacacgcaggcagtgaccactctggtcggtgagaccgtgccggtcaccaac
gcctccgagcgctggaccatctccgagatcagctag

DBGET integrated database retrieval system