KEGG   Planococcus versutus: I858_003350Help
Entry
I858_003350       CDS       T04421                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
pll  Planococcus versutus
Pathway
pll00970  Aminoacyl-tRNA biosynthesis
pll01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pll00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    I858_003350
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pll03029]
    I858_003350
Enzymes [BR:pll01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     I858_003350
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     I858_003350
Mitochondrial biogenesis [BR:pll03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    I858_003350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey Aconitase_B_N
Motif
Other DBs
NCBI-ProteinID: ANU26071
UniProt: A0A1B1RYR1
Position
903365..904795
Genome map
AA seq 476 aa AA seqDB search
MNFETIIGLEVHVELKTESKMFSPAPAHFGAEPNTNTNVIDLGYPGVLPVVNKTAVDWAM
RAALALNCEITRHTKFDRKNYFYPDNPKAYQISQFDQPIGEHGWIEIEVKGEKKRIGITR
LHMEEDAGKLTHTDKGYSLVDYNRQGTPLIEIVSEPDIRTADEAYAYLEKIKAIIQYTGV
SDVRMEEGSLRCDANISLRPFGQEQFGTKTELKNLNSFNFVRKGIEHEQVRQEQVLLSGG
IIEQETRRYDESTGKTLLMRVKEGSDDYRYFPEPDLVDIVIDDAWLERVRSEIPELPDAR
KARYVSELGMSSYDAMVLTLAKPISDFFEATVTAGADAKLSSNWLMGEVSAYLNAEQKEL
EGTELTPEGLAGMIKLISDGTISSKIAKKVFKELIEKGGDANDIVKAKGLVQISDQNTLR
EFVTAALDNNPQSIEDFKNGKDRAIGFLVGQIMKQTKGQANPPLLNKILLEEIAKR
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaattttgaaacaattatcggacttgaagtccacgtagaacttaaaacagaatctaaa
atgttttctccagcaccggctcactttggtgcagaaccaaataccaatacaaacgtcatt
gaccttggatatccgggtgttttaccagtagtgaataaaacagcagtggactgggcaatg
agagcggcacttgcgttaaattgtgaaattacgcgccacacaaaattcgaccgtaaaaac
tatttctatccagacaatccgaaagcttaccaaatttcacaatttgatcagccgatcggt
gagcacggctggattgaaatcgaagtcaaaggcgagaaaaaacgcattggcattacgcgt
cttcatatggaagaagatgcaggaaaactaacgcataccgacaaaggttattcattagtc
gattataaccgtcaaggaacgccgttaattgaaatcgtttcagagcctgatattcgtacg
gcggatgaagcatacgcctaccttgaaaaaatcaaagcaattattcaatatacaggcgtc
tccgatgtgcgtatggaagaaggatcattgcgttgcgacgcgaacatttcacttcgtccg
tttggtcaagaacaatttggtacaaaaaccgaattgaaaaacttgaactcgttcaacttt
gttcgcaaaggaattgaacacgagcaagttcgtcaagaacaagtgttattgtccggtggg
atcatcgagcaagaaacacgtcgttacgacgaatccacagggaaaaccttgttgatgcgc
gtaaaagaaggatcggacgattatcgttacttcccagaacctgatcttgttgatatcgtc
attgatgatgcttggttagaacgcgtgcgttcagaaattccagaattgccagatgctaga
aaagcacgctacgtttcagaacttggtatgtcttcttacgatgctatggttctgacacta
gcaaaacctatttcggatttctttgaagcgacagtaactgctggtgccgatgcgaaactt
tcatctaactggttgatgggtgaagtatcagcttacttgaacgctgagcaaaaagaactt
gaaggtacggaattaacaccagaaggtttggctggtatgatcaaattgatttcagatggt
acgatttcgtctaaaatcgccaagaaagtttttaaagaattgattgaaaaaggcggcgac
gcgaacgatatcgtcaaagcgaaaggacttgttcagatctctgaccaaaacacattgcgt
gaatttgttacagcagctcttgacaacaatccgcaatcgattgaagactttaaaaacggt
aaagaccgtgcaatcggttttcttgtcgggcaaattatgaaacaaacaaaagggcaagca
aacccaccattgcttaataaaattcttcttgaagaaattgcaaaaagataa

DBGET integrated database retrieval system