KEGG   Planococcus versutus: I858_008385Help
Entry
I858_008385       CDS       T04421                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pll  Planococcus versutus
Pathway
pll00480  Glutathione metabolism
pll00590  Arachidonic acid metabolism
pll01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pll00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    I858_008385
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    I858_008385
Enzymes [BR:pll01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     I858_008385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin GAD DDE_Tnp_ISAZ013
Motif
Other DBs
NCBI-ProteinID: ANU27011
UniProt: A0A1B1S1F3
Position
complement(3129289..3129765)
Genome map
AA seq 158 aa AA seqDB search
MTIYDIAVPKPDGEEYLLNEYKGKAMLIVNTATKCGLRDQFEDLEKLYEEYKDQGLVVLG
FPSNQFKQEEATGAEAQEVCQMTYGVTFPMHDLIKVNGEDAHPLFSYLTSNTKGFLTSGI
KWNFTKFLVDQNGNIISRFSPKDTPRSFEKDIQKVLAK
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgactatttacgatatcgctgtaccaaaaccagacggagaagaatacctattaaacgaa
tacaaagggaaagctatgctcatcgtcaacacggcaaccaaatgtggattgcgtgatcag
tttgaggacctcgaaaaactgtacgaagaatacaaagatcaaggattggttgttcttggc
tttccatctaatcagtttaaacaagaagaagctaccggtgcagaagcacaagaagtgtgt
caaatgacgtatggtgtcacttttcccatgcacgacttgataaaggttaacggagaagat
gcacatccgctgtttagctatttaacgagtaacacaaagggatttctaacaagtggcatc
aaatggaacttcacgaaattcttagttgatcaaaacggcaacatcatttcacggttttcg
ccaaaagatacacctcgatcatttgaaaaagatattcaaaaagtactcgccaagtaa

DBGET integrated database retrieval system