KEGG   Planococcus versutus: I858_009930Help
Entry
I858_009930       CDS       T04421                                 

Definition
(GenBank) beta-ketoadipyl CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pll  Planococcus versutus
Pathway
pll00071  Fatty acid degradation
pll00072  Synthesis and degradation of ketone bodies
pll00280  Valine, leucine and isoleucine degradation
pll00310  Lysine degradation
pll00362  Benzoate degradation
pll00380  Tryptophan metabolism
pll00620  Pyruvate metabolism
pll00630  Glyoxylate and dicarboxylate metabolism
pll00640  Propanoate metabolism
pll00650  Butanoate metabolism
pll00900  Terpenoid backbone biosynthesis
pll01100  Metabolic pathways
pll01110  Biosynthesis of secondary metabolites
pll01120  Microbial metabolism in diverse environments
pll01130  Biosynthesis of antibiotics
pll01200  Carbon metabolism
pll01212  Fatty acid metabolism
pll02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pll00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    I858_009930
   00630 Glyoxylate and dicarboxylate metabolism
    I858_009930
   00640 Propanoate metabolism
    I858_009930
   00650 Butanoate metabolism
    I858_009930
  Lipid metabolism
   00071 Fatty acid degradation
    I858_009930
   00072 Synthesis and degradation of ketone bodies
    I858_009930
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    I858_009930
   00310 Lysine degradation
    I858_009930
   00380 Tryptophan metabolism
    I858_009930
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    I858_009930
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    I858_009930
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    I858_009930
Enzymes [BR:pll01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     I858_009930
Exosome [BR:pll04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   I858_009930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C SpoVAD Dodecin ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ANU27306
UniProt: A0A1B1S286
Position
complement(2822199..2823380)
Genome map
AA seq 393 aa AA seqDB search
MNNVYLIDGARTAFGGFGGSLATTDATELGAATAVEALKRSNVKAEDINHVFYGNVIQSS
VNSAYLARHIGLKAGVPKEVPALTLNRLCGSGAQAVVTAAQHILLGEAELVLAGGTENMS
MSPYANFDQRFSKSKMGNLQFEDMLTATLTDQYTGSGMGMTAEKLAEQYNISREEQDAFS
VQSNQRATQAVESGRFAEEIVAMNVTTRKGVLVVDKDEHIKPDANEEALAKLRPSFKKEG
TVTAGNASGINDGAASLVVASEAAVSKHNLKPMARIVSWGVVGVDPTIMGIGPVPAIKQA
LKRAELTVADIDLFEVNEAFAAQYLAVEKELGLDREKVNVNGGAIALGHPVGASGARILL
SLAYELKRRGGKYGVASLCIGGGQGIAVVIEHA
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaataatgtttacttaatagacggagccagaacggcttttggcggctttggcggatcg
cttgcgacaaccgatgcgactgaacttggagcagctacagcagttgaggcgttaaaacgc
tcaaatgtaaaagcagaagacatcaaccatgttttttacggaaatgttattcaatctagc
gtgaatagcgcttacttagcccgtcatattggattaaaagcaggtgtgccaaaagaagtt
ccagcgctcacgttaaatcggttatgtggatcaggtgcacaagctgttgtgacagcagca
caacacatcttactaggtgaagcggaattggtattggctggaggtactgagaacatgtca
atgtctccgtatgccaattttgatcagcgctttagcaaatctaaaatgggcaatttgcaa
tttgaagatatgttaacggcgacgttgacggaccaatatacaggaagtgggatgggcatg
actgccgaaaaactggcagagcaatacaatatttcgcgtgaagagcaagatgccttttct
gtgcaatccaatcaacgagctacacaagcagtcgaatctgggagatttgcagaagaaatt
gtagcaatgaatgtgacaacgcgtaaaggtgtgttagttgtcgacaaagatgaacatata
aaaccagacgcaaatgaagaagctctagccaaacttcgtccttcatttaaaaaagaagga
acggtaacagctggaaacgcttcaggtataaatgacggagcggcttcactcgttgtagca
agcgaagcggccgtaagcaaacacaatttaaaaccaatggcgcgtattgtctcgtggggt
gtcgtcggcgtagacccaaccattatgggtattggaccggtgccagcgattaaacaagca
ttaaaacgtgcagagttgactgttgctgatattgatttgtttgaggttaatgaagcattc
gcggcgcaatatttggcagtagaaaaagaacttggattagatcgagagaaagtaaacgtc
aacggcggcgcaattgcactaggtcatccagtcggcgcaagtggtgcgcgtattttatta
tctcttgcgtatgaattgaaacgtcgtggaggtaaatacggtgtggcaagtttgtgtatt
ggaggaggtcaaggaattgcggtggtgattgaacatgcttaa

DBGET integrated database retrieval system