KEGG   Planococcus versutus: I858_010650Help
Entry
I858_010650       CDS       T04421                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pll  Planococcus versutus
Pathway
pll00071  Fatty acid degradation
pll00072  Synthesis and degradation of ketone bodies
pll00280  Valine, leucine and isoleucine degradation
pll00310  Lysine degradation
pll00362  Benzoate degradation
pll00380  Tryptophan metabolism
pll00620  Pyruvate metabolism
pll00630  Glyoxylate and dicarboxylate metabolism
pll00640  Propanoate metabolism
pll00650  Butanoate metabolism
pll00900  Terpenoid backbone biosynthesis
pll01100  Metabolic pathways
pll01110  Biosynthesis of secondary metabolites
pll01120  Microbial metabolism in diverse environments
pll01130  Biosynthesis of antibiotics
pll01200  Carbon metabolism
pll01212  Fatty acid metabolism
pll02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pll00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    I858_010650
   00630 Glyoxylate and dicarboxylate metabolism
    I858_010650
   00640 Propanoate metabolism
    I858_010650
   00650 Butanoate metabolism
    I858_010650
  09103 Lipid metabolism
   00071 Fatty acid degradation
    I858_010650
   00072 Synthesis and degradation of ketone bodies
    I858_010650
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    I858_010650
   00310 Lysine degradation
    I858_010650
   00380 Tryptophan metabolism
    I858_010650
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    I858_010650
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    I858_010650
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    I858_010650
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pll04147]
    I858_010650
Enzymes [BR:pll01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     I858_010650
Exosome [BR:pll04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   I858_010650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD
Motif
Other DBs
NCBI-ProteinID: ANU27448
UniProt: A0A1B1S2N4
Position
complement(2677792..2678985)
Genome map
AA seq 397 aa AA seqDB search
MAKTVIIDGARTVFGKFGGNLSTLTASDLGAAAIKAAMSRAGIQPADVQEVIMGNVLQAG
QGQIPSRQAAVKAGIPYNVKSETINKVCASGMRSVTLADQIIRLGDEEVIVAGGMESMSN
APYYLPKARWGLRMGDAQVIDGMVHDGLSCSFHPDRVHMGTYGNSTAEDFDLTREEQDNW
SARSHERAIKAKDLFAEEIVAIDIPQRKGDPITVDTDEAPRANSTVEALAKLKPAFGKDG
TITAGNAPGINDGAAALVLMNEERAQKEGKNILAHILSHTEIAIEPHRFPETPGIVINEL
LKKTGKSLEEIDLFEINEAFAAVALASSEIAGLDAEKVNVNGGSVALGHPIGASGSRIIL
TLAYELRRRGGGIGIAAICSGGGQGDAIMIEVPKEAN
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaacagtcatcattgatggagcacgtacagtatttggtaagttcggtggaaac
ttgagcacgttgacagcaagcgatcttggagcagcagctatcaaagctgcaatgagccgt
gcaggtattcaaccagcagatgttcaagaagtgattatgggtaacgtgttgcaagctgga
caaggacaaatcccttctcgccaagcagctgttaaggcaggaattccatataacgtaaaa
tctgaaacaattaacaaagtatgtgcatcgggcatgcgcagtgttacattggcagaccaa
attattcgtttaggtgatgaagaagtaattgtagcaggtggcatggagtccatgtcgaat
gcaccttattatttaccaaaagcacgttggggtcttcgcatgggcgatgcacaagtaatt
gatggcatggtccacgatggattatcatgctcattccatccagaccgcgttcacatggga
acttacggcaactcaacagctgaagattttgacttaacgcgcgaagagcaagacaactgg
tcagcccgctcacatgaacgtgcaatcaaagcgaaagatttattcgcagaagaaattgtt
gcaatcgatattccacagcgtaaaggtgatcctattaccgtggataccgacgaagcgcct
cgcgccaattcgaccgtggaagcattagcgaaattaaagccggcatttggtaaagacggc
acaatcacggccggaaacgcacctggcattaatgacggagcagcagcacttgtgttaatg
aatgaagagcgtgcacaaaaagaaggcaaaaacatactggctcatatcctttctcataca
gaaatagccattgaacctcatcgtttcccagaaactccaggaatcgtaatcaatgagcta
ttaaagaaaacaggtaaatcattagaagaaatcgatttattcgaaatcaatgaagcattt
gctgcagttgcattagcaagctcggaaattgcaggactcgatgctgaaaaagtaaacgtt
aatggcggatcagttgcacttggacacccaattggagcaagtggttcacgtattatcctc
acacttgcttacgaactaagacgtcgtggaggcggcatcggcatcgcggcaatctgctca
ggtggcggacaaggtgatgcaattatgattgaagttccaaaggaggcaaactaa

DBGET integrated database retrieval system