KEGG   Planococcus versutus: I858_010715Help
Entry
I858_010715       CDS       T04421                                 

Definition
(GenBank) fructose-bisphosphatase, class II
  KO
K02446  fructose-1,6-bisphosphatase II [EC:3.1.3.11]
Organism
pll  Planococcus versutus
Pathway
pll00010  Glycolysis / Gluconeogenesis
pll00030  Pentose phosphate pathway
pll00051  Fructose and mannose metabolism
pll00680  Methane metabolism
pll01100  Metabolic pathways
pll01110  Biosynthesis of secondary metabolites
pll01120  Microbial metabolism in diverse environments
pll01130  Biosynthesis of antibiotics
pll01200  Carbon metabolism
Module
pll_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pll00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    I858_010715
   00030 Pentose phosphate pathway
    I858_010715
   00051 Fructose and mannose metabolism
    I858_010715
  09102 Energy metabolism
   00680 Methane metabolism
    I858_010715
Enzymes [BR:pll01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     I858_010715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_glpX
Motif
Other DBs
NCBI-ProteinID: ANU27460
UniProt: A0A1B1S2P6
Position
complement(2662570..2663535)
Genome map
AA seq 321 aa AA seqDB search
MERSLSMELVRITEAAAIASSKWMGRGLKNEADDAATTAMRTVFDTIPMRGVVVIGEGEM
DEAPMLYIGEELGTGNGPEVDVAVDPLEGTNIVAAGGWNALAVLAIADRGNLLNAPDMYM
EKIAVGPESVGKIDINAPVIDNLRAVAKAKNKNIEEVVATVMDRPRHQAIIDQIREAGAR
IKLISDGDVAGAINTAFDQTGVDILFGTGGAPEGVIAAVGLKCLGGEIQGKLKPQNQEEA
QRCLDMGIDVNQVLMMDDLVKGDDAIFAATGVTDGELLKGVQLKGGFAESHTLVMRAKSG
TIRFIEGRHSLAKKPNLVMND
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggaacgaagtctatcgatggaattagtgcgcattactgaagcggcagcaattgcttct
tcaaaatggatgggccgcggcttgaaaaacgaagcagatgacgcagcaacaaccgctatg
agaacggtatttgataccattccaatgcgtggagttgtggttattggtgaaggagaaatg
gacgaagcgcctatgctttatatcggtgaagaattaggaacaggcaacggtccagaagtg
gacgttgctgttgatcctttagaaggaacaaacatcgtggccgcgggtggctggaatgca
ttagcagttctcgcaatcgccgatcgaggcaatcttctaaacgcaccggatatgtatatg
gaaaaaattgcggttgggccagagtcagtaggcaaaatcgacattaatgcgccagttatc
gataaccttcgtgcagtagcaaaagccaaaaataaaaacatcgaagaagtcgttgccaca
gttatggatcgaccccgtcaccaagctattatcgatcaaattcgtgaagcaggcgctcgt
atcaaactgatatctgatggtgatgtagctggagctatcaatacagcttttgatcaaacc
ggcgttgatattttatttggtactggtggagcacctgaaggcgttatcgctgcagtaggc
ttaaaatgccttggcggtgaaattcaaggaaagcttaaaccacaaaaccaagaagaagca
cagcgctgtctggatatgggcattgatgtaaaccaagtgttgatgatggacgatctcgtt
aaaggcgatgacgctattttcgcggctaccggcgttacagacggagagctgttaaaaggt
gttcaactaaaaggtggttttgcagaaagccatacattggtgatgcgtgcaaaatctgga
acaattcgctttatcgaaggccgtcacagcttggcaaaaaagccgaatcttgtcatgaac
gattaa

DBGET integrated database retrieval system