KEGG   Planococcus versutus: I858_011285Help
Entry
I858_011285       CDS       T04421                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
pll  Planococcus versutus
Pathway
pll00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:pll00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    I858_011285
Enzymes [BR:pll01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     I858_011285
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     I858_011285
    1.1.1.-  
     I858_011285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc AlaDh_PNT_C 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ANU27568
UniProt: A0A1B1S306
Position
complement(2528045..2529094)
Genome map
AA seq 349 aa AA seqDB search
MKAAVWYGEKDIRVEERELKVLQDNEVTVRVAWAGICGSDLHEYQEGPVIIPVEENNELT
GQQAPLTMGHEFAGVVEKVGKDVTSVKEGDRVAINPMYTFGNKPEDVDAYDGFQFIGLGS
DGGFAKYVNAGESFVYKLPEGMTLQDGALVEPTAVAVQAVKEGNMQFGDTVAVFGAGPIG
LLTIIAAKAAGASKIFSFDLSEERLQKAKELGATHVFNSGQVDPVEALKNVIPEGVDVTF
EVAGVAPTFKQAIDVTRARGTMVIVSIFARPIEWNPMQLTSTGVKVTSSIAYTPTTFQQT
VDLIGTGQLKPQGVITSQIELDDIVEKGFEALTNDKSQSKILVELSGEM
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcagtatggtatggagaaaaagacatccgggtggaagaacgtgaactaaaa
gttttgcaggacaatgaagtaactgtgcgtgtagcgtgggctggcatttgcggttcggat
ctgcatgaatatcaggaaggtcctgttatcatccctgttgaggaaaataatgagttgact
ggccaacaggctcctctcacaatgggacatgaatttgcgggggtagtcgaaaaagttggg
aaagacgtgacatctgtcaaagaaggagaccgtgttgcgattaaccctatgtacacattc
ggcaacaagccggaagatgtggatgcctatgatggtttccaattcatcggtttgggctct
gatggtggatttgccaagtatgtaaacgccggtgagagttttgtctataaattgccagaa
ggtatgacattgcaggatggcgcgttggtcgaaccgacagcggtggctgtacaagccgtt
aaagaaggcaatatgcaatttggtgacaccgtcgcagtattcggtgcaggtccgattggt
ttgcttaccattattgctgctaaagcggctggcgcaagcaaaatcttctcattcgatctg
tctgaagagcgcttgcaaaaagccaaagaactgggagctacccacgtcttcaattcaggc
caggtggatcctgtagaagcgttgaaaaatgtaatccctgaaggtgtggacgtaactttc
gaagtggccggtgtcgcaccgacatttaaacaggctattgatgtaacgcgtgcacggggc
acaatggtcattgtatcgatttttgcacgcccgatcgaatggaatcctatgcaattgacc
agtacaggcgtaaaagtgacatcgtctattgcctacacgcctacaacattccagcaaacg
gttgatttgatcggtacaggacagttgaaaccacaaggtgtcatcacttcccagattgaa
ttggacgacatcgtggaaaaagggttcgaagcactgactaatgacaaatcccaatcaaaa
attctcgttgaattaagcggggaaatgtaa

DBGET integrated database retrieval system