KEGG   Planococcus versutus: I858_011345Help
Entry
I858_011345       CDS       T04421                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
pll  Planococcus versutus
Pathway
pll00260  Glycine, serine and threonine metabolism
pll01100  Metabolic pathways
pll01110  Biosynthesis of secondary metabolites
pll01120  Microbial metabolism in diverse environments
pll01130  Biosynthesis of antibiotics
pll01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pll00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    I858_011345
Enzymes [BR:pll01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     I858_011345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 Aminotran_1_2 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: ANU27579
UniProt: A0A1B1S357
Position
complement(2514768..2515796)
Genome map
AA seq 342 aa AA seqDB search
MTTKMFASDNNSGVHPLILEAIVQANQGHVAAYGNDPYTAEAIQKFKAHFGEACEVAFVF
NGTGANVTGLKAMVRSHQAIICTDGAHINSDEGGAPEGFIGGKLLTSPSADGKLTISQIE
RQLHHIGNPQRSQPKVVSISQCTELGTVYTIDEIKEITRFAHENGLYVHMDGARLSNAAA
HLGCSFAEMTVDAGIDMLAFGGTKNGLMMGEAVVCFNPELASEITYIRKQGMQLGSKMRF
LAVQFDRLLTNDLWLDNARSANHMAQLLAEGLVKFPEITLSQPVQSNAIFALLPKAQIQH
LQKKHSFALWNEEKDEIRLVTSFDTEKEDIAHFLADVKNSFS
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgaaaatgtttgcaagcgacaacaattcaggagttcacccgctcattttagaa
gccatcgttcaagcgaatcaaggacatgttgcggcttacggaaacgatccgtacacggca
gaggctattcaaaaattcaaagctcattttggtgaagcgtgcgaagtggcatttgttttt
aatggcacgggtgccaatgtgacaggattaaaagcaatggtgcgttcgcatcaagccatt
atttgcacagacggcgcgcacattaactcagacgaaggcggcgcaccagaagggtttatt
ggagggaaactgctaacgtctccgtcagcggatggcaaactgacgattagccaaatcgag
cgtcaactgcatcacataggcaacccgcagcgaagccagccaaaagtcgtttcgatctca
caatgcacagaactcggaacggtttacacaattgacgaaatcaaggaaatcactcgtttt
gcccacgaaaatggactgtatgtacatatggacggagcacgactcagcaacgcagcagct
cacctcggttgcagttttgccgaaatgacagtagatgcgggtatcgacatgctggcgttt
gggggaacgaaaaatggcttgatgatgggcgaggcggtcgtctgtttcaatccggaattg
gcgtctgagatcacatacattcgaaaacaaggcatgcaactcggctctaaaatgcgcttt
ctggcggtgcaatttgaccgattgttaacgaatgacctatggctagacaatgcccgaagt
gccaaccatatggcgcagctacttgcagaagggttagtcaaatttccagaaatcacgctt
tctcagccggttcagtcaaatgcgattttcgctttattgccaaaagcacaaatccaacac
cttcagaaaaaacattcgtttgcgttatggaacgaagaaaaagatgaaattcggttggtg
acttctttcgatactgaaaaagaagacatcgcgcactttcttgcggatgttaaaaacagc
ttttcatga

DBGET integrated database retrieval system