KEGG   Planctopirus limnophila: Plim_2816Help
Entry
Plim_2816         CDS       T01225                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
plm  Planctopirus limnophila
Brite
KEGG Orthology (KO) [BR:plm00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Plim_2816
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ADG68638
UniProt: D5SRE5
Position
complement(3654701..3655678)
Genome map
AA seq 325 aa AA seqDB search
MLAVLTILLILAVGFVAFTNGANANFKGVASLYGSGTATLRQALYWGTATTLAGSMASIF
LAEGLLKAFSGKGIVPDELVRSPGFLSAVAVGAACTSFLATRLGFPVSTTHALVGGITGA
GLAGSGTNVEFSALGKTFLYPLFFSPVVAVIVGGMAYLTLRLCHLAPDHRTRTLDVLHYA
SAGAASFARGLNDTPKMVALLMVLPEMKESTGFYGGYLGVAVLIALGGLLDADKVAETLG
KKVTAMNPGQGFAASLTTALLVTTASFHSLPVSTTHVSVGSLLGIGITTGQAKWRTVGEI
LLAWVSTVPVGALLGALAYVVISRI
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
gtgctcgccgtgctgacgatcttgttgatacttgctgttggcttcgtggcatttacgaat
ggcgctaatgccaacttcaagggtgtggcctcgctctatggcagtggtacagccacctta
aggcaagccctttactgggggacggccacgactttggccggttcaatggcctccattttt
cttgcagaaggcttactgaaggctttcagcgggaaagggattgtccctgatgagttggtt
cggtctccgggctttttgagtgcagtcgctgtgggggctgcgtgcaccagttttctggcg
acaagactgggctttcccgtctcgaccacacatgccctggtcggtgggatcaccggggcc
ggtctggctgggagtggtacgaatgtcgagttttcagcactgggtaaaacgtttctttat
ccactgttcttcagcccggtcgtggctgtcattgttggtggcatggcttatctaactttg
aggttatgccatctggcacctgatcatcgcacgcgaacactcgatgtcctgcactatgcc
agtgcgggggctgccagttttgcgcggggtttgaatgatactcccaaaatggtcgcactc
ctgatggtgttacccgagatgaaagaatcaacagggttctatggaggatatctgggtgtc
gctgtgctgatcgcgctgggcgggttactggatgccgacaaagtggcagaaacgctggga
aagaaggtcaccgccatgaatcccggtcaggggtttgctgccagtctgacgacagcgctc
ctggtaaccactgccagctttcacagcctgcccgtcagcaccacgcatgtcagtgtgggc
tcgctgctgggaatcggcatcaccaccggccaggccaaatggcgcacggtgggagaaatt
ctgctggcctgggtcagcacagtccccgttggtgctctcctgggggcattggcgtatgtc
gtcatctcgcggatctga

DBGET integrated database retrieval system