KEGG   Planctopirus limnophila: Plim_3423Help
Entry
Plim_3423         CDS       T01225                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
plm  Planctopirus limnophila
Pathway
plm00310  Lysine degradation
plm01100  Metabolic pathways
plm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:plm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    Plim_3423
Enzymes [BR:plm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     Plim_3423
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO NAD_binding_8 Sacchrp_dh_NADP Thi4 Pyr_redox_2 NAD_binding_9 Mqo AlaDh_PNT_C FAD_binding_2 NAD_binding_7 HI0933_like ApbA TrkA_N Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ADG69236
UniProt: D5SUV0
Position
complement(4434621..4435823)
Genome map
AA seq 400 aa AA seqDB search
MVRSDVVIIGAGIVGLATAYRLLERFPKAVITVLDKEREIAQHQTGHNSGVLHTGIYYKP
GTMRAINAREGKLLLEQFCDQHDIPYECCGKVIVATQEAELPQLDKLFERAMANGVRAEK
ITAERLREIEPYASGVAALHVPEAGIIDYRQVCDKMAEMIRQQGNTILTSARVYGMYRDG
NYMVVETTRGPVEGKTVINCGGLQSDRLTWLSGQMPPAQIVPFRGEYFELKPSAHKLCRG
LIYPVPDPNFPFLGVHLTRMIHGGVECGPNAVLAFSREGYHKTSFNPYDLFETITYRGFL
LLMLRNWDEGLRELWRSLSKKAFVTALQKLVPDINSDDLIPAPAGVRAQALLPTGELADD
FLIQERDLVVNVCNAPSPAATASLKIGDFVVDQIANRLAS
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgatctgatgtcgtcattattggagccggaattgtcggcctggcgacggcgtat
cgcctgctcgaacgctttcccaaagcggtgattacagtcctcgataaagagcgcgaaatc
gcccagcatcaaaccgggcataactcgggcgtcctgcataccggtatctattacaaaccc
ggcaccatgcgggccatcaatgcccgggaagggaagttactgctcgaacaattctgcgat
cagcacgatattccctacgagtgttgcggcaaggtgatcgtggctactcaagaggccgaa
ttgccacaactcgacaaactctttgagcgcgccatggccaatggtgtccgggcggaaaag
atcactgccgaacgacttcgcgagattgaaccttacgccagcggtgtggccgcactgcat
gtgccggaagcgggcatcatcgattaccggcaagtctgcgacaaaatggccgaaatgatc
cgacagcaaggaaacacaattctgacatctgcccgtgtctacggcatgtaccgcgacggg
aattacatggtcgtcgaaaccactcgcggccctgtggaaggcaaaaccgtgatcaattgc
gggggcttacaaagtgatcgactcacatggctctccggacaaatgccacccgctcagatt
gtcccgttccgaggcgagtactttgagctgaaaccttcagcgcacaaactctgccggggc
ttgatctatccagttcccgacccgaattttccctttctgggtgtgcatctgacccgcatg
attcacggcggagtcgagtgcggcccaaacgctgtgctggccttttctcgcgagggctac
cataaaaccagcttcaacccctacgatcttttcgaaacgatcacctatcgtggctttttg
ctcctgatgctccgtaactgggatgaagggttgcgggaactctggcgttcactcagcaaa
aaagcctttgtcacagcgcttcaaaagctggttccggatatcaactccgacgacctgatc
ccggcaccagccggggtgagggcacaagccttactgccgacgggcgaactggcggatgat
tttctgattcaggagcgcgacctggttgtcaacgtctgcaatgctccgtcaccggcagcg
acggcttcgctcaaaattggcgactttgttgtcgatcagattgccaatcggctggcctcc
tga

DBGET integrated database retrieval system