KEGG   Planococcus sp. PAMC 21323: Plano_0627Help
Entry
Plano_0627        CDS       T03510                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pln  Planococcus sp. PAMC 21323
Pathway
pln00071  Fatty acid degradation
pln00072  Synthesis and degradation of ketone bodies
pln00280  Valine, leucine and isoleucine degradation
pln00310  Lysine degradation
pln00362  Benzoate degradation
pln00380  Tryptophan metabolism
pln00620  Pyruvate metabolism
pln00630  Glyoxylate and dicarboxylate metabolism
pln00640  Propanoate metabolism
pln00650  Butanoate metabolism
pln00900  Terpenoid backbone biosynthesis
pln01100  Metabolic pathways
pln01110  Biosynthesis of secondary metabolites
pln01120  Microbial metabolism in diverse environments
pln01130  Biosynthesis of antibiotics
pln01200  Carbon metabolism
pln01212  Fatty acid metabolism
pln02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pln00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Plano_0627
   00630 Glyoxylate and dicarboxylate metabolism
    Plano_0627
   00640 Propanoate metabolism
    Plano_0627
   00650 Butanoate metabolism
    Plano_0627
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Plano_0627
   00072 Synthesis and degradation of ketone bodies
    Plano_0627
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Plano_0627
   00310 Lysine degradation
    Plano_0627
   00380 Tryptophan metabolism
    Plano_0627
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Plano_0627
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Plano_0627
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Plano_0627
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pln04147]
    Plano_0627
Enzymes [BR:pln01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Plano_0627
Exosome [BR:pln04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Plano_0627
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Ketoacyl-synt_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AIY04592
UniProt: A0A0B4RA12
Position
630696..631829
Genome map
AA seq 377 aa AA seqDB search
MTNVYVHGIGMTKFGTLTSSLKELLLEASAEALIDAGRPKIDAVFVGNFMGGSIANQEIL
GAIVANELGLGYIPSTKVEGACASGGIAFRQGLLGIMSGEYETVLVAGVEKMKHATTPDV
TQAINAAMDTTTNEKHAGLTFPGFFGVLANRYFHETGATKEHLARVALKNRQNAVNNPLA
QFAKPTTLEEIMNARMITDPLGLFDCSPMTDGASAIVISRKKSPIYVKASSQVSGPTKMQ
DASNLLSLPAIGESGRLAYEKAGVGPEDIDVVEIHDCFSMTEIIATEELGFFNPLEGWKA
IEEGRTQVTGDKPVNTSGGLLSRGHPIGATGIAQIYQLVRQLRGNAANQLEKTPRLALAQ
NLGGTGSYSTVHILERV
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatgtttatgtacatggtattggcatgacgaagtttggtacattaacgtcttca
ttgaaagaattactattagaggcaagcgctgaagctttgatcgatgctggccgtccaaaa
atagatgctgtatttgttggtaactttatggggggcagtattgccaatcaagaaatttta
ggagctattgttgcaaatgaattaggtcttggctatattccttcaacaaaagtcgaaggt
gcatgcgcttcaggaggaatcgcttttcgtcaagggttattaggtatcatgagtggagaa
tacgaaacggtattagtagccggtgttgaaaagatgaagcatgctactacgccagatgtt
acgcaagcaatcaatgctgcaatggatacgacgaccaatgaaaaacatgcaggactaaca
ttcccaggtttcttcggcgttttagcaaaccgatatttccatgagacgggtgcaaccaaa
gagcatttggcacgcgtggcattaaaaaatcgtcaaaatgcggtaaataatccgctcgct
caattcgctaagccgacaacactggaagaaataatgaatgcacgtatgattacagatcca
ctcggtttgttcgattgttcaccaatgaccgatggtgcatctgctattgtcatttcacgt
aaaaaatctccgatatatgtgaaagcatcgtcgcaagtgtcgggacctactaaaatgcaa
gacgcttctaacttattatcactaccagcgattggcgaatcagggcgtcttgcttacgaa
aaagcaggtgtagggccagaggatattgatgtagtagaaattcatgactgcttctcgatg
actgaaatcatcgctacagaagaacttggattttttaatccattagaagggtggaaagcg
atagaagaagggcgcacacaagtaacgggggataagcctgtaaacacaagtggtgggtta
ttatctcgtggtcatccaattggcgcaacgggaatcgcacaaatttatcaattggtccgt
caattgcgaggaaatgcagccaatcaactagagaaaacgcctcgactcgctttggcacaa
aatttaggtggcacaggttcgtactcaactgtccacatactagaaagggtgtaa

DBGET integrated database retrieval system