KEGG   Planococcus sp. PAMC 21323: Plano_1906Help
Entry
Plano_1906        CDS       T03510                                 

Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pln  Planococcus sp. PAMC 21323
Pathway
pln00020  Citrate cycle (TCA cycle)
pln00640  Propanoate metabolism
pln00660  C5-Branched dibasic acid metabolism
pln01100  Metabolic pathways
pln01110  Biosynthesis of secondary metabolites
pln01120  Microbial metabolism in diverse environments
pln01130  Biosynthesis of antibiotics
pln01200  Carbon metabolism
Module
pln_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pln_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pln00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Plano_1906
   00640 Propanoate metabolism
    Plano_1906
   00660 C5-Branched dibasic acid metabolism
    Plano_1906
Enzymes [BR:pln01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Plano_1906
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A Citrate_bind
Motif
Other DBs
NCBI-ProteinID: AIY05871
UniProt: A0A0B4RCZ7
Position
complement(1925101..1926261)
Genome map
AA seq 386 aa AA seqDB search
MNIHEYQGKELLRQYGVAVSYGTVAFSPEEAVKAAKELSTDVVVVKAQIHAGGRGKAGGV
KIAKNLDEVRAYAKELLGKVLVTHQTGPEGKEIKRLLIEEGSDIKKEYYIGLVLDRQTAR
VTLMGSEEGGVDIEEVSENTPEKIFKEVIDPVIGLTGFQARRMAFNMNIPPKLVNKAAKF
MLGLYTVFIEKDASIVEINPLVETGDGNILALDAKFDFDENALYRHKDIVELRDFDEEDP
KEIEASKYDLSYISLDGNIGCMVNGAGLAMATMDTINYYGGTPANFLDVGGGATAEKVTE
AFKIILSDKNVKGIFVNIFGGIMKCDIIAEGVIQAAKEVSLEVPLVVRLEGTNVELGKKL
LNESGLNIVAAGTMADGAKQIVELVG
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccatgaatatcaaggaaaagaactcctcagacaatacggagtagcagtttct
tacggcactgttgctttttctccggaagaagcagttaaggcagctaaagaactgagtact
gatgttgtcgtggtaaaagcacaaatccacgcaggtggacgaggcaaagctggcggtgtt
aaaatcgctaaaaatctggatgaagtccgtgcatacgcgaaagaacttttaggtaaagtt
cttgtgactcaccagacaggtccagaaggtaaagaaattaaacgccttttgatcgaagaa
ggatctgacattaagaaggagtattacatcggattggtgctagatcgccaaactgctcgt
gtcactcttatgggctctgaagagggcggagtcgatatcgaagaagtttctgaaaacact
cctgaaaaaatcttcaaagaagtaatcgatccagtaatcggtttgactggtttccaggca
cgccgtatggctttcaacatgaacatcccgccaaagcttgtaaacaaagcggcgaaattc
atgcttggactatacacagtatttatcgaaaaagatgcgtctatcgttgagattaacccg
ttagttgaaactggcgacggcaatattttagcacttgatgcgaaatttgatttcgatgaa
aacgctctttaccgccacaaagatattgtggaacttcgcgatttcgacgaagaagatcca
aaagaaattgaagcctctaagtatgacttaagctacatttctttagatgggaacatcggc
tgtatggttaacggcgccggacttgctatggcaactatggacacgatcaactattacggc
ggaacacccgctaacttccttgacgttgggggcggtgccactgctgagaaagtaacggaa
gctttcaaaatcattctttctgataagaatgtaaaaggaattttcgttaacattttcggc
ggtatcatgaagtgtgacatcattgcggaaggcgttattcaagctgctaaagaagtaagc
cttgaagtgccattagtagtccgtcttgaaggaacaaacgtagaacttggtaaaaaactg
cttaatgaatcaggtcttaatatcgtagctgctggaacaatggcagacggcgctaaacag
atcgtagaacttgtaggctaa

DBGET integrated database retrieval system