KEGG   Planococcus sp. PAMC 21323: Plano_2312Help
Entry
Plano_2312        CDS       T03510                                 

Definition
(GenBank) Zn-dependent dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
pln  Planococcus sp. PAMC 21323
Pathway
pln00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:pln00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Plano_2312
Enzymes [BR:pln01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Plano_2312
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Plano_2312
    1.1.1.-  
     Plano_2312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc AlaDh_PNT_C 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AIY06277
UniProt: A0A0B4REP7
Position
complement(2359461..2360510)
Genome map
AA seq 349 aa AA seqDB search
MKAAVWYGEKDIRVEERELKVLQDNEVTVRVAWAGICGSDLHEYQEGPVFIPVEKNNELT
GQQAPLTMGHEFAGVVEKVGKDVTSVKEGDRVAINPMYTFGNKPEDVDAYDGFQFIGLGS
DGGFAKYVNAGESFVYKLPEGMTLQDGALVEPTAVAVQAVKEGNMQFGDTVAVFGAGPIG
LLTIIAAKAAGASKIFSFDLSEERLQKAKELGATHVFNSGQVDPVEALKNVIPEGVDVTF
EVAGVAPTFKQAIDVTRARGTMVIVSIFARPIEWNPMQLTSTGVKVTSSIAYTPTTFQQT
VDLIGTGQLKPQGVITSQIELDDIVEKGFEALTNDKSQSKILVELSGEM
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcagtatggtatggagaaaaagacatccgggtggaagaacgtgaactaaaa
gttttgcaggacaatgaagtaactgtgcgtgtagcgtgggctggcatttgcggttcggat
ctgcatgaatatcaggaaggtcctgttttcatccctgttgagaaaaataatgagttgact
ggccaacaggctcctctcacaatgggacatgaatttgcgggggtagtcgaaaaagttggg
aaagacgtcacatctgtcaaagaaggagaccgtgttgcgattaaccctatgtacacattc
ggcaacaagccggaagatgtggatgcctatgatggtttccaattcatcggtttgggctct
gacggtggattcgccaagtatgtaaacgccggtgagagctttgtctataaattaccagaa
ggtatgacgttgcaggatggcgcgttggtcgaaccgacagcggtggctgtacaagccgtt
aaagaaggcaatatgcaatttggtgacaccgtcgcagtatttggtgcaggtccgattggt
ttgcttaccattattgctgctaaagcggctggcgcaagcaaaatcttctcattcgatctg
tctgaagagcgcttgcaaaaagccaaagaactgggagctacccacgtcttcaattcaggc
caggtggatcctgtagaagcgttgaaaaatgtaatccctgaaggtgtggacgtaactttc
gaagtggccggtgtcgcaccgacattcaaacaggctattgacgtaacgcgtgcacggggc
acaatggtcattgtatcgatttttgcacgcccgatcgaatggaatcctatgcaattgacc
agtacaggcgtaaaagtgacatcgtctattgcctacacgcctacaacattccagcaaacg
gttgatttgatcggtacaggacagttgaaaccacaaggtgtcatcacttcccagattgaa
ttggacgacatcgtggaaaaagggttcgaagcactgactaatgacaaatcccaatcaaaa
attctcgttgaattaagcggggaaatgtag

DBGET integrated database retrieval system